BLASTX nr result
ID: Atractylodes22_contig00018177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018177 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519858.1| hypothetical protein RCOM_0865530 [Ricinus c... 55 6e-06 >ref|XP_002519858.1| hypothetical protein RCOM_0865530 [Ricinus communis] gi|223540904|gb|EEF42462.1| hypothetical protein RCOM_0865530 [Ricinus communis] Length = 174 Score = 55.1 bits (131), Expect = 6e-06 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -3 Query: 308 ELYEKGHRILMELTDCGILKEQEGGYVFMDKSLLN-VDDLYQCLDQIASLGLATVFTSD- 135 E Y +GH+ILMEL + G+LK QE + M+ S+LN VD + A +GLA V D Sbjct: 28 EAYGEGHQILMELINRGVLKIQEDNIIVMEGSMLNLVDHRLRGYFATAKVGLANVLKVDK 87 Query: 134 IDGFGRITHDHGMLKTPWTSNKGK 63 G GRIT GM+K T KG+ Sbjct: 88 WKGLGRITLVDGMIKMLHTGIKGE 111