BLASTX nr result
ID: Atractylodes22_contig00017888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017888 (599 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527241.1| APO protein 4, mitochondrial precursor, puta... 131 8e-29 ref|XP_002327942.1| predicted protein [Populus trichocarpa] gi|2... 129 5e-28 ref|XP_002273999.2| PREDICTED: APO protein 4, mitochondrial-like... 125 7e-27 ref|XP_004158556.1| PREDICTED: APO protein 4, mitochondrial-like... 122 4e-26 ref|XP_004151879.1| PREDICTED: APO protein 4, mitochondrial-like... 122 4e-26 >ref|XP_002527241.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis] gi|223533417|gb|EEF35167.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis] Length = 325 Score = 131 bits (330), Expect = 8e-29 Identities = 58/78 (74%), Positives = 68/78 (87%) Frame = +1 Query: 1 KFESWRGSHLWKKAEVDDLLPPKVVWFRRPQDPTVLQDKCRSFYGHAPAVVDLCTKAGAI 180 K+ESWRGSH W++A VDDL+PPK+VW RRPQDP VL ++ R+FYGHAPA+VDLCTKAGAI Sbjct: 248 KYESWRGSHFWERARVDDLVPPKIVWRRRPQDPPVLLNEGRNFYGHAPAIVDLCTKAGAI 307 Query: 181 ASPKYYCMMKVQGLSADV 234 A KYYCMMK QGL+A V Sbjct: 308 APTKYYCMMKNQGLTAPV 325 >ref|XP_002327942.1| predicted protein [Populus trichocarpa] gi|222837351|gb|EEE75730.1| predicted protein [Populus trichocarpa] Length = 308 Score = 129 bits (323), Expect = 5e-28 Identities = 58/78 (74%), Positives = 63/78 (80%) Frame = +1 Query: 1 KFESWRGSHLWKKAEVDDLLPPKVVWFRRPQDPTVLQDKCRSFYGHAPAVVDLCTKAGAI 180 KFESW G H WKKAEVDDL+PPK+VW RRPQDP VL ++ R FYGHAPAVVDLCTK G I Sbjct: 229 KFESWHGKHFWKKAEVDDLVPPKIVWRRRPQDPLVLVNEGRDFYGHAPAVVDLCTKTGII 288 Query: 181 ASPKYYCMMKVQGLSADV 234 KY CMMK+QGLSA V Sbjct: 289 VPTKYSCMMKIQGLSAPV 306 >ref|XP_002273999.2| PREDICTED: APO protein 4, mitochondrial-like [Vitis vinifera] Length = 329 Score = 125 bits (313), Expect = 7e-27 Identities = 55/74 (74%), Positives = 65/74 (87%) Frame = +1 Query: 1 KFESWRGSHLWKKAEVDDLLPPKVVWFRRPQDPTVLQDKCRSFYGHAPAVVDLCTKAGAI 180 K+ESWRG+H WKKA+VDDL+PPK+VW +RPQDP VL ++ R FYGHAPAVVDLCTKAGAI Sbjct: 248 KYESWRGAHFWKKADVDDLVPPKIVWRQRPQDPPVLVNEGRDFYGHAPAVVDLCTKAGAI 307 Query: 181 ASPKYYCMMKVQGL 222 A +Y+ MMKVQGL Sbjct: 308 APARYHSMMKVQGL 321 >ref|XP_004158556.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus] Length = 330 Score = 122 bits (307), Expect = 4e-26 Identities = 55/77 (71%), Positives = 64/77 (83%) Frame = +1 Query: 4 FESWRGSHLWKKAEVDDLLPPKVVWFRRPQDPTVLQDKCRSFYGHAPAVVDLCTKAGAIA 183 +ESWRGSH W+KA+VDDL+PPK+VW RR QDP VL DK + +YGHAPAVV LCT+AG IA Sbjct: 250 YESWRGSHFWEKADVDDLVPPKIVWHRRQQDPPVLVDKGKDYYGHAPAVVALCTQAGVIA 309 Query: 184 SPKYYCMMKVQGLSADV 234 KY+CMMKVQGLS V Sbjct: 310 PFKYHCMMKVQGLSPRV 326 >ref|XP_004151879.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus] Length = 330 Score = 122 bits (307), Expect = 4e-26 Identities = 55/77 (71%), Positives = 64/77 (83%) Frame = +1 Query: 4 FESWRGSHLWKKAEVDDLLPPKVVWFRRPQDPTVLQDKCRSFYGHAPAVVDLCTKAGAIA 183 +ESWRGSH W+KA+VDDL+PPK+VW RR QDP VL DK + +YGHAPAVV LCT+AG IA Sbjct: 250 YESWRGSHFWEKADVDDLVPPKIVWHRRQQDPPVLVDKGKDYYGHAPAVVALCTQAGVIA 309 Query: 184 SPKYYCMMKVQGLSADV 234 KY+CMMKVQGLS V Sbjct: 310 PFKYHCMMKVQGLSPRV 326