BLASTX nr result
ID: Atractylodes22_contig00017856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017856 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 56 3e-06 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 55 8e-06 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -2 Query: 261 VNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWR 142 V PK Q G+F FLP R P+PTSGPSR+HNDIG QSWR Sbjct: 47 VKPKNQHRGHFLNFLP-RHFPIPTSGPSRRHNDIGLQSWR 85 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 255 PKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWR 142 PKTQ+ G+F FLP R P+PTSGPSR+HN IG Q+WR Sbjct: 40 PKTQYKGHFLNFLP-RHLPIPTSGPSRRHNGIGLQNWR 76 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 261 VNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWR 142 V PK++ G+FFGFLPKR +P S PSRKHNDIG +SWR Sbjct: 36 VKPKSEHQGHFFGFLPKRMH-IPYSTPSRKHNDIGLRSWR 74 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -2 Query: 276 HVFRVVNPKTQFSGNFFGFLPKRKTPLPTSGPSRKHNDIGPQSWR 142 +VF+V PK + G+FFGFLP+R P+P S PSRKHNDIG QS R Sbjct: 32 NVFKV-KPKYEHKGHFFGFLPRR-IPIPYSSPSRKHNDIGLQSLR 74