BLASTX nr result
ID: Atractylodes22_contig00017730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017730 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ29017.1| WRKY4 [Panax quinquefolius] 91 7e-17 ref|XP_002270750.2| PREDICTED: LOW QUALITY PROTEIN: WRKY transcr... 86 4e-15 emb|CBI36956.3| unnamed protein product [Vitis vinifera] 86 4e-15 gb|AEO31482.1| WRKY transcription factor 3-1 [Dimocarpus longan] 85 5e-15 ref|XP_002515275.1| conserved hypothetical protein [Ricinus comm... 84 1e-14 >gb|AEQ29017.1| WRKY4 [Panax quinquefolius] Length = 271 Score = 91.3 bits (225), Expect = 7e-17 Identities = 40/55 (72%), Positives = 46/55 (83%), Gaps = 1/55 (1%) Frame = -2 Query: 163 RKVAEKIVVTVKLNEENDGKKRSENPS-FDCWSWRKYGQKPIKGSPYPRGYYRCS 2 RK+A+K VV VK+ E +GK++SE P DCWSWRKYGQKPIKGSPYPRGYYRCS Sbjct: 27 RKLAQKTVVAVKIEENENGKQKSEGPPPSDCWSWRKYGQKPIKGSPYPRGYYRCS 81 >ref|XP_002270750.2| PREDICTED: LOW QUALITY PROTEIN: WRKY transcription factor 22 [Vitis vinifera] Length = 233 Score = 85.5 bits (210), Expect = 4e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 163 RKVAEKIVVTVKLNEENDGKKRSENPSFDCWSWRKYGQKPIKGSPYPRGYYRCS 2 R+V +K VVTV++ E N GK+++E P D WSWRKYGQKPIKGSPYPRGYYRCS Sbjct: 21 RRVVQKTVVTVRI-EANVGKQKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCS 73 >emb|CBI36956.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 85.5 bits (210), Expect = 4e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 163 RKVAEKIVVTVKLNEENDGKKRSENPSFDCWSWRKYGQKPIKGSPYPRGYYRCS 2 R+V +K VVTV++ E N GK+++E P D WSWRKYGQKPIKGSPYPRGYYRCS Sbjct: 21 RRVVQKTVVTVRI-EANVGKQKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCS 73 >gb|AEO31482.1| WRKY transcription factor 3-1 [Dimocarpus longan] Length = 75 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -2 Query: 163 RKVAEKIVVTVKLNEENDGKKRSENPSFDCWSWRKYGQKPIKGSPYPRGYYRCS 2 RK+ +K VVTVK+ E N GK ++E P D WSWRKYGQKPIKGSP+PRGYYRCS Sbjct: 1 RKLVQKTVVTVKIGE-NGGKLKNEGPPSDLWSWRKYGQKPIKGSPHPRGYYRCS 53 >ref|XP_002515275.1| conserved hypothetical protein [Ricinus communis] gi|223545755|gb|EEF47259.1| conserved hypothetical protein [Ricinus communis] Length = 265 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -2 Query: 163 RKVAEKIVVTVKLNEENDGKKRSENPSFDCWSWRKYGQKPIKGSPYPRGYYRCS 2 RKV EK VVTVK+ E N K +++ P D WSWRKYGQKPIKGSPYPRGYYRCS Sbjct: 26 RKVVEKTVVTVKI-EANARKLKNDGPPSDFWSWRKYGQKPIKGSPYPRGYYRCS 78