BLASTX nr result
ID: Atractylodes22_contig00017672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017672 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548449.1| PREDICTED: TMV resistance protein N-like [Gl... 57 2e-06 >ref|XP_003548449.1| PREDICTED: TMV resistance protein N-like [Glycine max] Length = 1289 Score = 57.0 bits (136), Expect = 2e-06 Identities = 38/85 (44%), Positives = 51/85 (60%), Gaps = 3/85 (3%) Frame = -1 Query: 248 LSLPHSLQRLFLNDCNLEHTESFPLSFRH--KLQYLNLSSGLFESLPS-YGHLQTLQVLD 78 L+LP SL R+ L+ CNL ESFP FRH LQ+L+L+ F +LPS +L L++L Sbjct: 858 LNLP-SLMRINLSYCNLSE-ESFPDGFRHLSSLQFLDLTGNNFVTLPSCISNLTKLEILL 915 Query: 77 FTYCSRLKRLQDLPSTLVELYVYYC 3 C +LKRL +LPS + L C Sbjct: 916 LNLCKKLKRLPELPSRMKHLDASNC 940