BLASTX nr result
ID: Atractylodes22_contig00017573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017573 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533502.1| conserved hypothetical protein [Ricinus comm... 113 2e-23 ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|2... 113 2e-23 ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250... 111 6e-23 ref|XP_002527250.1| conserved hypothetical protein [Ricinus comm... 109 2e-22 ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|2... 109 3e-22 >ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis] gi|223526646|gb|EEF28889.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 113 bits (282), Expect = 2e-23 Identities = 56/100 (56%), Positives = 71/100 (71%) Frame = -3 Query: 528 FEIARQTNQFQRFSQKLPTVFVGKSADLKLIVKLMSDEIRRSLKSRGLLLPPWRKNRFMQ 349 FEIAR TN++++ Q LP VFVGKS +LK I+K+MSD +RSLK+R L LPPWRKNR+MQ Sbjct: 177 FEIARPTNEYRKQVQSLPRVFVGKSENLKRIIKVMSDAAKRSLKTRDLSLPPWRKNRYMQ 236 Query: 348 NKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGF 229 NKW GPY RT N+ LS+ P + + S V+ L GF Sbjct: 237 NKWLGPYHRTCNHQ----LSANPTMIEASVSVVKCRLFGF 272 >ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|222850077|gb|EEE87624.1| predicted protein [Populus trichocarpa] Length = 289 Score = 113 bits (282), Expect = 2e-23 Identities = 54/76 (71%), Positives = 61/76 (80%) Frame = -3 Query: 528 FEIARQTNQFQRFSQKLPTVFVGKSADLKLIVKLMSDEIRRSLKSRGLLLPPWRKNRFMQ 349 FEIAR T+QF + LP VFVG+S DLK IVK +SD +RSLKSR L LPPWRKNR+MQ Sbjct: 186 FEIARPTSQFLKLQHSLPRVFVGRSEDLKTIVKSISDASKRSLKSRELSLPPWRKNRYMQ 245 Query: 348 NKWFGPYRRTVNYTPA 301 NKWFGPYRRTVN +PA Sbjct: 246 NKWFGPYRRTVNPSPA 261 >ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250319 [Vitis vinifera] gi|296090565|emb|CBI40915.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 111 bits (278), Expect = 6e-23 Identities = 58/103 (56%), Positives = 69/103 (66%) Frame = -3 Query: 528 FEIARQTNQFQRFSQKLPTVFVGKSADLKLIVKLMSDEIRRSLKSRGLLLPPWRKNRFMQ 349 FEIAR T+Q++R Q LP VF+GKS DLK IVKL D +RSLKSRGL LPPWRKNR+MQ Sbjct: 177 FEIARPTDQYKRLIQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQ 236 Query: 348 NKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGFNVV 220 NKWFGP RRT +P P+ T V+ +GF+ V Sbjct: 237 NKWFGPCRRTATPSP-------PLAPASTEFTVKCRSVGFDAV 272 >ref|XP_002527250.1| conserved hypothetical protein [Ricinus communis] gi|223533343|gb|EEF35094.1| conserved hypothetical protein [Ricinus communis] Length = 286 Score = 109 bits (273), Expect = 2e-22 Identities = 55/101 (54%), Positives = 71/101 (70%) Frame = -3 Query: 528 FEIARQTNQFQRFSQKLPTVFVGKSADLKLIVKLMSDEIRRSLKSRGLLLPPWRKNRFMQ 349 FEIAR T ++ + Q LP VFVGK+ DLK I+K+MSD +RSLKSR L LPPWRKNR+MQ Sbjct: 177 FEIARPTKEYWKQVQSLPIVFVGKNEDLKRIIKVMSDAAKRSLKSRDLSLPPWRKNRYMQ 236 Query: 348 NKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGFN 226 NKW GPY RT N+ + +SS P + + V+ L+GF+ Sbjct: 237 NKWLGPYCRTSNH---HQISSNPTMIGAAGNGVKCRLVGFD 274 >ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|222848523|gb|EEE86070.1| predicted protein [Populus trichocarpa] Length = 289 Score = 109 bits (272), Expect = 3e-22 Identities = 58/100 (58%), Positives = 69/100 (69%) Frame = -3 Query: 528 FEIARQTNQFQRFSQKLPTVFVGKSADLKLIVKLMSDEIRRSLKSRGLLLPPWRKNRFMQ 349 FEIAR T+Q+ + LP VFVGKS DLK IV+ +SD +RSLKSR L LPPWRKNR+MQ Sbjct: 183 FEIARPTSQYLKLLHHLPRVFVGKSEDLKTIVRSISDAAKRSLKSRELSLPPWRKNRYMQ 242 Query: 348 NKWFGPYRRTVNYTPANILSSFPVPVNHTTSAVQYSLIGF 229 NKWFGPY RTVN P N SF P + + V+ +GF Sbjct: 243 NKWFGPYLRTVNPLPTN---SFTPP--PSVNVVKCRRVGF 277