BLASTX nr result
ID: Atractylodes22_contig00017545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017545 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267328.2| PREDICTED: putative glycerol-3-phosphate tra... 59 1e-15 ref|XP_002324576.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-15 emb|CAN70162.1| hypothetical protein VITISV_043651 [Vitis vinifera] 59 5e-15 ref|XP_003546598.1| PREDICTED: putative glycerol-3-phosphate tra... 55 2e-14 ref|XP_002532502.1| Regulatory protein uhpC, putative [Ricinus c... 52 4e-14 >ref|XP_002267328.2| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Vitis vinifera] Length = 490 Score = 58.5 bits (140), Expect(2) = 1e-15 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 118 APFNSARGAHRLGELDLVFLSAYSLGMYFSGH 213 APFN G HRLGELDL FLS+YS+GMYFSGH Sbjct: 73 APFNGPHGTHRLGELDLAFLSSYSIGMYFSGH 104 Score = 48.9 bits (115), Expect(2) = 1e-15 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 6 LLITFLAYAAFHASRKPPSIVKSVL 80 LLITF+AYA+FHASRKPPSIVKSVL Sbjct: 33 LLITFVAYASFHASRKPPSIVKSVL 57 >ref|XP_002324576.1| predicted protein [Populus trichocarpa] gi|222866010|gb|EEF03141.1| predicted protein [Populus trichocarpa] Length = 506 Score = 59.3 bits (142), Expect(2) = 4e-15 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 118 APFNSARGAHRLGELDLVFLSAYSLGMYFSGH 213 APFN +G HRLGELDL FLSAYS+GMYF+GH Sbjct: 83 APFNGPKGTHRLGELDLAFLSAYSIGMYFAGH 114 Score = 46.6 bits (109), Expect(2) = 4e-15 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +3 Query: 6 LLITFLAYAAFHASRKPPSIVKSVL 80 L ITFLAYA+FHASRKPPSIVK VL Sbjct: 33 LAITFLAYASFHASRKPPSIVKGVL 57 >emb|CAN70162.1| hypothetical protein VITISV_043651 [Vitis vinifera] Length = 488 Score = 58.5 bits (140), Expect(2) = 5e-15 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 118 APFNSARGAHRLGELDLVFLSAYSLGMYFSGH 213 APFN G HRLGELDL FLS+YS+GMYFSGH Sbjct: 73 APFNGPHGTHRLGELDLAFLSSYSIGMYFSGH 104 Score = 47.0 bits (110), Expect(2) = 5e-15 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +3 Query: 6 LLITFLAYAAFHASRKPPSIVKSVL 80 LLITF+AYA+FHASR PPSIVKSVL Sbjct: 33 LLITFIAYASFHASRXPPSIVKSVL 57 >ref|XP_003546598.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Glycine max] Length = 492 Score = 54.7 bits (130), Expect(2) = 2e-14 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +1 Query: 121 PFNSARGAHRLGELDLVFLSAYSLGMYFSGH 213 PFN RG HRLGELDL FL++YS+GMY +GH Sbjct: 80 PFNGTRGTHRLGELDLAFLTSYSIGMYLAGH 110 Score = 48.9 bits (115), Expect(2) = 2e-14 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 6 LLITFLAYAAFHASRKPPSIVKSVL 80 L+ITFLAYA+FHASRKPPSIVKSVL Sbjct: 33 LVITFLAYASFHASRKPPSIVKSVL 57 >ref|XP_002532502.1| Regulatory protein uhpC, putative [Ricinus communis] gi|223527777|gb|EEF29878.1| Regulatory protein uhpC, putative [Ricinus communis] Length = 473 Score = 52.4 bits (124), Expect(2) = 4e-14 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 118 APFNSARGAHRLGELDLVFLSAYSLGMYFSGH 213 APFN++ G RLGELDL FL +YS+GMYF+GH Sbjct: 82 APFNASDGTRRLGELDLAFLLSYSIGMYFAGH 113 Score = 50.1 bits (118), Expect(2) = 4e-14 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 6 LLITFLAYAAFHASRKPPSIVKSVL 80 LLITFLAYA+FHASRKPPSIVKSVL Sbjct: 28 LLITFLAYASFHASRKPPSIVKSVL 52