BLASTX nr result
ID: Atractylodes22_contig00017299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017299 (1331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515261.1| carboxypeptidase regulatory region-containin... 86 2e-14 ref|XP_004170617.1| PREDICTED: nodal modulator 1-like, partial [... 84 6e-14 ref|XP_004135986.1| PREDICTED: nodal modulator 2-like [Cucumis s... 84 6e-14 ref|XP_003554555.1| PREDICTED: nodal modulator 1-like [Glycine max] 79 3e-12 ref|XP_003625987.1| Nodal modulator [Medicago truncatula] gi|355... 79 3e-12 >ref|XP_002515261.1| carboxypeptidase regulatory region-containingprotein, putative [Ricinus communis] gi|223545741|gb|EEF47245.1| carboxypeptidase regulatory region-containingprotein, putative [Ricinus communis] Length = 1198 Score = 85.9 bits (211), Expect = 2e-14 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = -1 Query: 1310 QLGEVTSKHYLIEATKEHYKFSKLINLMVLPNMTSVVDIKAVSYDVCGSVETVDYGYKAK 1131 +L +VTS HY IEA KEHY+F+ L MVLPNM SV DIKA+SYDVCG V V+ GYKAK Sbjct: 362 KLDQVTSNHYTIEARKEHYRFNSLKEYMVLPNMASVADIKAISYDVCGVVRMVNSGYKAK 421 Query: 1130 V 1128 V Sbjct: 422 V 422 >ref|XP_004170617.1| PREDICTED: nodal modulator 1-like, partial [Cucumis sativus] Length = 728 Score = 84.3 bits (207), Expect = 6e-14 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = -1 Query: 1310 QLGEVTSKHYLIEATKEHYKFSKLINLMVLPNMTSVVDIKAVSYDVCGSVETVDYGYKAK 1131 +L +VTS HY IEA K+H+KF+KL N MVLPNM SV DIKA YDVCG V+T+ GYK+K Sbjct: 180 KLDQVTSNHYTIEARKKHFKFNKLENYMVLPNMISVADIKATLYDVCGVVKTIGDGYKSK 239 Query: 1130 V 1128 V Sbjct: 240 V 240 >ref|XP_004135986.1| PREDICTED: nodal modulator 2-like [Cucumis sativus] Length = 1199 Score = 84.3 bits (207), Expect = 6e-14 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = -1 Query: 1310 QLGEVTSKHYLIEATKEHYKFSKLINLMVLPNMTSVVDIKAVSYDVCGSVETVDYGYKAK 1131 +L +VTS HY IEA K+H+KF+KL N MVLPNM SV DIKA YDVCG V+T+ GYK+K Sbjct: 362 KLDQVTSNHYTIEARKKHFKFNKLENYMVLPNMISVADIKATLYDVCGVVKTIGDGYKSK 421 Query: 1130 V 1128 V Sbjct: 422 V 422 >ref|XP_003554555.1| PREDICTED: nodal modulator 1-like [Glycine max] Length = 1195 Score = 79.0 bits (193), Expect = 3e-12 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = -1 Query: 1310 QLGEVTSKHYLIEATKEHYKFSKLINLMVLPNMTSVVDIKAVSYDVCGSVETVDYGYKAK 1131 +L +VTS HY IEA KEHYKF KL N MVLPNM S+ DI A+SY++CG V G KAK Sbjct: 363 KLDQVTSTHYTIEAQKEHYKFKKLENYMVLPNMASIEDINAISYNLCGLVRMASGGLKAK 422 Query: 1130 V 1128 V Sbjct: 423 V 423 >ref|XP_003625987.1| Nodal modulator [Medicago truncatula] gi|355501002|gb|AES82205.1| Nodal modulator [Medicago truncatula] Length = 1288 Score = 78.6 bits (192), Expect = 3e-12 Identities = 39/61 (63%), Positives = 44/61 (72%) Frame = -1 Query: 1310 QLGEVTSKHYLIEATKEHYKFSKLINLMVLPNMTSVVDIKAVSYDVCGSVETVDYGYKAK 1131 +L +VTS HY IEA K+HYKF KL N MVLPNM S+ DI AVSYD+CG V V G KA Sbjct: 455 KLDQVTSTHYTIEARKKHYKFKKLENYMVLPNMASIEDIVAVSYDLCGLVRMVSSGQKAT 514 Query: 1130 V 1128 V Sbjct: 515 V 515