BLASTX nr result
ID: Atractylodes22_contig00017054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017054 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144627.1| PREDICTED: RING-H2 finger protein ATL18-like... 65 6e-09 ref|XP_002454042.1| hypothetical protein SORBIDRAFT_04g023620 [S... 59 5e-07 ref|XP_002514390.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_003609920.1| RING-H2 finger protein ATL3J [Medicago trunc... 57 1e-06 ref|XP_003609919.1| RING finger protein [Medicago truncatula] gi... 57 1e-06 >ref|XP_004144627.1| PREDICTED: RING-H2 finger protein ATL18-like [Cucumis sativus] gi|449500186|ref|XP_004161028.1| PREDICTED: RING-H2 finger protein ATL18-like [Cucumis sativus] Length = 125 Score = 65.1 bits (157), Expect = 6e-09 Identities = 25/71 (35%), Positives = 44/71 (61%) Frame = +3 Query: 18 CLLELPIIQFEDLQNRHGSVDRMCFICSADYDKDDVLCQLSRCGHVFHSECVGKLLHQKH 197 C ++L + +FE+LQ GS + +C +C ++ ++ ++ QL RC HVFH EC+ L + Sbjct: 52 CEVKLLVCRFEELQRAVGSEEEICSVCLTEFTREHLVSQLHRCSHVFHLECIESWLQRNQ 111 Query: 198 TSCPFCCTPVF 230 +CP C + +F Sbjct: 112 FTCPLCRSFIF 122 >ref|XP_002454042.1| hypothetical protein SORBIDRAFT_04g023620 [Sorghum bicolor] gi|241933873|gb|EES07018.1| hypothetical protein SORBIDRAFT_04g023620 [Sorghum bicolor] Length = 359 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 6/88 (6%) Frame = +3 Query: 30 LPIIQFEDLQNRHGSVDRM------CFICSADYDKDDVLCQLSRCGHVFHSECVGKLLHQ 191 LP++ F +++ +H VD C +C ++D DD L L C H FH EC+G L + Sbjct: 97 LPLVFFREVR-QHRIVDGRGDDALECSVCLLEFDDDDALRLLPTCPHAFHPECIGLWL-E 154 Query: 192 KHTSCPFCCTPVFSGISPVPCSSC*KHQ 275 +H +CP C V P P + +HQ Sbjct: 155 RHATCPLCRASVLDAPPPPPAPAAAQHQ 182 >ref|XP_002514390.1| conserved hypothetical protein [Ricinus communis] gi|223546487|gb|EEF47986.1| conserved hypothetical protein [Ricinus communis] Length = 85 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +3 Query: 18 CLLELPIIQFEDLQN-RHGSVDRMCFICSADYDKDDVLCQLSRCGHVFHSECVGKLLHQK 194 C+ + +F +LQ GS + +C IC ++++ D + Q+SRC H+FH +C+ K L + Sbjct: 12 CINGVAAARFGELQRCGSGSDENLCCICLVEFEEGDEVSQVSRCMHLFHLDCIAKWLQRH 71 Query: 195 HTSCPFCCTPVF 230 + +CP C + VF Sbjct: 72 NFTCPLCRSLVF 83 >ref|XP_003609920.1| RING-H2 finger protein ATL3J [Medicago truncatula] gi|355510975|gb|AES92117.1| RING-H2 finger protein ATL3J [Medicago truncatula] Length = 146 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 6/80 (7%) Frame = +3 Query: 18 CLLELPIIQFEDLQNRHGSVDRMCFICSADYDKDDVLCQLSRCGHVFHSECVGKLLHQKH 197 C LP+ F +++ RH + C +C +D + +L C HVFH EC+ K L H Sbjct: 42 CCQMLPLTSFGEIKERHPETEETCAVCLNKLKMEDEVRELMNCDHVFHKECIDKWLEHGH 101 Query: 198 ------TSCPFCCTPVFSGI 239 +CP C P+ + + Sbjct: 102 DNENHNQTCPLCRAPLINSV 121 >ref|XP_003609919.1| RING finger protein [Medicago truncatula] gi|355510974|gb|AES92116.1| RING finger protein [Medicago truncatula] gi|388516109|gb|AFK46116.1| unknown [Medicago truncatula] Length = 169 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Frame = +3 Query: 18 CLLELPIIQFEDLQNRHGSVDRMCFICSADYDKDDVLCQLSRCGHVFHSECVGKLLHQKH 197 C LP+ F +++ RH + C +C +D + +L C HVFH EC+ K L H Sbjct: 56 CCQMLPLTSFGEIKERHPETEETCAVCLNKLKMEDEVRELMNCDHVFHKECIDKWLEHGH 115 Query: 198 ------TSCPFCCTPVFSGIS 242 +CP C P+ + S Sbjct: 116 DNENHNQTCPLCRAPLINSYS 136