BLASTX nr result
ID: Atractylodes22_contig00017019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017019 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25257.3| unnamed protein product [Vitis vinifera] 94 1e-17 ref|XP_002271902.1| PREDICTED: nudix hydrolase 3-like [Vitis vin... 94 1e-17 dbj|BAC42449.1| unknown protein [Arabidopsis thaliana] 91 7e-17 ref|NP_565218.1| nudix hydrolase 3 [Arabidopsis thaliana] gi|685... 91 7e-17 ref|XP_003543339.1| PREDICTED: nudix hydrolase 3-like [Glycine max] 90 2e-16 >emb|CBI25257.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +2 Query: 122 ITHEEHFDVLTKAGHKTGFSKPRGAVHKNGDYHRAVHVWIFAESTQQLLLQRR 280 + HEEHFDVLTK G +TG SKPRG VH++GDYH AVHVWIF+ESTQ+LLLQRR Sbjct: 8 LLHEEHFDVLTKTGQRTGLSKPRGDVHRDGDYHAAVHVWIFSESTQELLLQRR 60 >ref|XP_002271902.1| PREDICTED: nudix hydrolase 3-like [Vitis vinifera] Length = 782 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +2 Query: 122 ITHEEHFDVLTKAGHKTGFSKPRGAVHKNGDYHRAVHVWIFAESTQQLLLQRR 280 + HEEHFDVLTK G +TG SKPRG VH++GDYH AVHVWIF+ESTQ+LLLQRR Sbjct: 5 LLHEEHFDVLTKTGQRTGLSKPRGDVHRDGDYHAAVHVWIFSESTQELLLQRR 57 >dbj|BAC42449.1| unknown protein [Arabidopsis thaliana] Length = 114 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 131 EEHFDVLTKAGHKTGFSKPRGAVHKNGDYHRAVHVWIFAESTQQLLLQRR 280 EEHFDVLTK+G KTG SKPRG VH++GDYHRAVHVWIF E+TQQLLLQ R Sbjct: 3 EEHFDVLTKSGEKTGVSKPRGEVHRDGDYHRAVHVWIFVETTQQLLLQLR 52 >ref|NP_565218.1| nudix hydrolase 3 [Arabidopsis thaliana] gi|68565909|sp|Q8L831.1|NUDT3_ARATH RecName: Full=Nudix hydrolase 3; Short=AtNUDT3 gi|21539559|gb|AAM53332.1| unknown protein [Arabidopsis thaliana] gi|23197868|gb|AAN15461.1| unknown protein [Arabidopsis thaliana] gi|332198166|gb|AEE36287.1| nudix hydrolase 3 [Arabidopsis thaliana] Length = 772 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 131 EEHFDVLTKAGHKTGFSKPRGAVHKNGDYHRAVHVWIFAESTQQLLLQRR 280 EEHFDVLTK+G KTG SKPRG VH++GDYHRAVHVWIF E+TQQLLLQ R Sbjct: 3 EEHFDVLTKSGEKTGVSKPRGEVHRDGDYHRAVHVWIFVETTQQLLLQLR 52 >ref|XP_003543339.1| PREDICTED: nudix hydrolase 3-like [Glycine max] Length = 768 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 131 EEHFDVLTKAGHKTGFSKPRGAVHKNGDYHRAVHVWIFAESTQQLLLQRR 280 EEH DVLTK G KTG SKPRG VH++GDYHRAVHVWIFAEST++LLLQRR Sbjct: 5 EEHLDVLTKTGLKTGVSKPRGDVHRDGDYHRAVHVWIFAESTRELLLQRR 54