BLASTX nr result
ID: Atractylodes22_contig00016654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016654 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 101 6e-20 ref|XP_002308958.1| calcium dependent protein kinase 8 [Populus ... 100 2e-19 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 99 3e-19 ref|XP_002322709.1| calcium dependent protein kinase 7 [Populus ... 99 3e-19 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 99 5e-19 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 101 bits (252), Expect = 6e-20 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 DTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNNLSLKLFKEGSLNLANEGR 167 DTDKDGRIS+EEF AMMKAGTDWRKASRQYSRER+NNLSLKL K+GSL ANEGR Sbjct: 475 DTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQSANEGR 529 >ref|XP_002308958.1| calcium dependent protein kinase 8 [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium dependent protein kinase 8 [Populus trichocarpa] Length = 528 Score = 100 bits (248), Expect = 2e-19 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = +3 Query: 3 DTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNNLSLKLFKEGSLNLANEGR 167 DTDKDG+IS+EEFT MMKAGTDWRKASRQYSRER+N+LSLKL ++GSL LANEGR Sbjct: 474 DTDKDGKISYEEFTTMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLKLANEGR 528 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 3 DTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNNLSLKLFKEGSLNLANEGR 167 DTDKDGRIS+EEF AMMKAGTDWRKASRQYSRER+N+LSLKL ++GSL L NEGR Sbjct: 478 DTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >ref|XP_002322709.1| calcium dependent protein kinase 7 [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium dependent protein kinase 7 [Populus trichocarpa] Length = 532 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 3 DTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNNLSLKLFKEGSLNLANEGR 167 DTDKDG+IS+EEF AMMKAGTDWRKASRQYSRER+NNLSLKL K+GSL L +EGR Sbjct: 478 DTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLKLTSEGR 532 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 98.6 bits (244), Expect = 5e-19 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +3 Query: 3 DTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNNLSLKLFKEGSLNLANEGR 167 DTDKDGRIS++EF AMMKAGTDWRKASRQYSRER+NNLSLKL ++GSL + NEGR Sbjct: 480 DTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534