BLASTX nr result
ID: Atractylodes22_contig00016648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016648 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615217.1| hypothetical protein MTR_5g065250 [Medicago ... 65 6e-09 gb|AER13156.1| putative retrotransposon [Phaseolus vulgaris] 62 4e-08 ref|XP_003613851.1| hypothetical protein MTR_5g041720 [Medicago ... 60 2e-07 ref|XP_003548385.1| PREDICTED: uncharacterized protein LOC100778... 58 7e-07 ref|XP_003605688.1| hypothetical protein MTR_4g036420 [Medicago ... 57 2e-06 >ref|XP_003615217.1| hypothetical protein MTR_5g065250 [Medicago truncatula] gi|355516552|gb|AES98175.1| hypothetical protein MTR_5g065250 [Medicago truncatula] Length = 660 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/76 (40%), Positives = 48/76 (63%) Frame = +2 Query: 2 SFMFFNFPKGWEVPQLWRMFKQHGRVVDIYIAKKRLLRGYRFGFVRFTEVNDKANLEERL 181 SF NF + + LW++F + GRV +++IAKK G RF F++F EV D LEE L Sbjct: 54 SFFVSNFSEEVTMEDLWKLFLKFGRVWEVFIAKKLDKWGRRFAFIKFREVADVVELEESL 113 Query: 182 RAIWIGSYKLRVFMAK 229 + +W G+ KL+V +++ Sbjct: 114 KEVWWGNLKLKVNLSR 129 >gb|AER13156.1| putative retrotransposon [Phaseolus vulgaris] Length = 1759 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/88 (37%), Positives = 53/88 (60%) Frame = +2 Query: 2 SFMFFNFPKGWEVPQLWRMFKQHGRVVDIYIAKKRLLRGYRFGFVRFTEVNDKANLEERL 181 +F F NFP G+ ++++F++ RV +++I+++ G RFGFVR +V + NLE+ L Sbjct: 44 TFFFSNFPNGFGEMDMFKIFQRWARVKEVFISRRLNKWGKRFGFVRLFDVKNVGNLEKEL 103 Query: 182 RAIWIGSYKLRVFMAKERGTYSEKNRRE 265 I+IGS KL V + K + E R E Sbjct: 104 DQIYIGSRKLFVNLPKYHRSRMESPRAE 131 >ref|XP_003613851.1| hypothetical protein MTR_5g041720 [Medicago truncatula] gi|355515186|gb|AES96809.1| hypothetical protein MTR_5g041720 [Medicago truncatula] Length = 278 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 3/90 (3%) Frame = +2 Query: 5 FMFFNFPKGWEVPQLWRMFKQHGRVVDIYIAKKRLLRGYRFGFVRFTEVNDKANLEERLR 184 F F N P V LW++F + G+V +++ K G FG V+F EV+++ +E+RL Sbjct: 3 FFFTNIPDDCYVSDLWKVFMRFGKVGQMFVLGKLDRWGRLFGLVKFKEVSNEEEVEKRLE 62 Query: 185 AIWIGSYKLRVFMA---KERGTYSEKNRRE 265 +W+G L+V A KE T E++RR+ Sbjct: 63 EVWMGDAGLKVNKARFGKEDNTSQEESRRK 92 >ref|XP_003548385.1| PREDICTED: uncharacterized protein LOC100778755 [Glycine max] Length = 1061 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/72 (45%), Positives = 42/72 (58%) Frame = +2 Query: 2 SFMFFNFPKGWEVPQLWRMFKQHGRVVDIYIAKKRLLRGYRFGFVRFTEVNDKANLEERL 181 SF F NF +LW FK G V +++IAK+R G RFGFVRF +V+D LE L Sbjct: 421 SFYFTNFTDNVNEVRLWGKFKIWGDVREVFIAKRRNKEGRRFGFVRFKDVSDVKLLETHL 480 Query: 182 RAIWIGSYKLRV 217 I+I +KL V Sbjct: 481 DNIFIDDHKLFV 492 >ref|XP_003605688.1| hypothetical protein MTR_4g036420 [Medicago truncatula] gi|355506743|gb|AES87885.1| hypothetical protein MTR_4g036420 [Medicago truncatula] Length = 260 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/76 (39%), Positives = 41/76 (53%) Frame = +2 Query: 2 SFMFFNFPKGWEVPQLWRMFKQHGRVVDIYIAKKRLLRGYRFGFVRFTEVNDKANLEERL 181 SF F N + LW + + G V ++ I KK RG R GFV F E+ D+ LEERL Sbjct: 59 SFFFTNVFDEVKTSVLWSLISRFGNVGEVLIPKKLSKRGRRLGFVNFKELEDQVALEERL 118 Query: 182 RAIWIGSYKLRVFMAK 229 +W G L+V +A+ Sbjct: 119 DEVWYGGSCLKVNLAR 134