BLASTX nr result
ID: Atractylodes22_contig00016630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016630 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530370.1| kinesin heavy chain, putative [Ricinus commu... 100 9e-20 ref|XP_003519030.1| PREDICTED: uncharacterized protein LOC100809... 92 6e-17 ref|XP_002308355.1| predicted protein [Populus trichocarpa] gi|2... 88 6e-16 ref|XP_003625307.1| Kinesin-like protein [Medicago truncatula] g... 84 2e-14 ref|XP_003520545.1| PREDICTED: uncharacterized protein LOC100787... 83 2e-14 >ref|XP_002530370.1| kinesin heavy chain, putative [Ricinus communis] gi|223530117|gb|EEF32031.1| kinesin heavy chain, putative [Ricinus communis] Length = 1010 Score = 100 bits (250), Expect = 9e-20 Identities = 62/97 (63%), Positives = 70/97 (72%), Gaps = 3/97 (3%) Frame = -3 Query: 283 RSFVPKVQTADNRVIQEQLNQKIDECEGLQETIASLKQVLSIAHDSRN*ARCT--SQHYS 110 +SF +V+ ADNRVIQEQLNQKI ECEGLQETI SLKQ L+ A + RN + SQ + Sbjct: 742 KSFELEVKAADNRVIQEQLNQKICECEGLQETIVSLKQQLADAQEMRNPSPLPSYSQRLA 801 Query: 109 RKKGLQGEPH-TEKENAETEDTKEDLLRQAQAFEIEE 2 + K L EPH EKENA TED KEDLLRQAQA E EE Sbjct: 802 QLKSLH-EPHQVEKENAATEDRKEDLLRQAQANETEE 837 >ref|XP_003519030.1| PREDICTED: uncharacterized protein LOC100809643 [Glycine max] Length = 989 Score = 91.7 bits (226), Expect = 6e-17 Identities = 51/93 (54%), Positives = 63/93 (67%) Frame = -3 Query: 283 RSFVPKVQTADNRVIQEQLNQKIDECEGLQETIASLKQVLSIAHDSRN*ARCTSQHYSRK 104 +SF +V+TADN +IQEQLNQKI ECE LQETI SLKQ L+ A + RN + H+S Sbjct: 732 KSFELEVKTADNHIIQEQLNQKIHECESLQETIGSLKQQLADALELRN---FSPHHFSVT 788 Query: 103 KGLQGEPHTEKENAETEDTKEDLLRQAQAFEIE 5 K GEPH +KE+A +T E +L Q QA EIE Sbjct: 789 KDYHGEPHLDKESAMITNTNEKILLQEQASEIE 821 >ref|XP_002308355.1| predicted protein [Populus trichocarpa] gi|222854331|gb|EEE91878.1| predicted protein [Populus trichocarpa] Length = 1011 Score = 88.2 bits (217), Expect = 6e-16 Identities = 51/96 (53%), Positives = 64/96 (66%), Gaps = 2/96 (2%) Frame = -3 Query: 283 RSFVPKVQTADNRVIQEQLNQKIDECEGLQETIASLKQVLSIAHDSRN*ARCT--SQHYS 110 +SF +V+ ADN +IQ+QL+QKI ECEGLQETI SLKQ LS A +S+N + SQ S Sbjct: 741 KSFELEVKAADNCIIQDQLSQKICECEGLQETIVSLKQQLSDALESKNISPLASYSQRIS 800 Query: 109 RKKGLQGEPHTEKENAETEDTKEDLLRQAQAFEIEE 2 K + H KE A ++D EDLL QAQA E+EE Sbjct: 801 ELKSFHAQHHMNKETAASKDRNEDLLLQAQATEMEE 836 >ref|XP_003625307.1| Kinesin-like protein [Medicago truncatula] gi|355500322|gb|AES81525.1| Kinesin-like protein [Medicago truncatula] Length = 1408 Score = 83.6 bits (205), Expect = 2e-14 Identities = 51/96 (53%), Positives = 64/96 (66%), Gaps = 2/96 (2%) Frame = -3 Query: 283 RSFVPKVQTADNRVIQEQLNQKIDECEGLQETIASLKQVLSIAHDSRN*ARCT--SQHYS 110 +SF +V+ ADNR+IQEQLNQKI ECE LQET+ASLKQ L+ A + RN + SQH+ Sbjct: 735 KSFELEVKAADNRIIQEQLNQKICECESLQETVASLKQQLTDAIELRNFSPVVNHSQHFP 794 Query: 109 RKKGLQGEPHTEKENAETEDTKEDLLRQAQAFEIEE 2 K GE + +K N ++ T E L QAQA EIEE Sbjct: 795 GTKDYHGELYPDKGNMDS--TNEGNLMQAQASEIEE 828 >ref|XP_003520545.1| PREDICTED: uncharacterized protein LOC100787892 [Glycine max] Length = 1007 Score = 83.2 bits (204), Expect = 2e-14 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%) Frame = -3 Query: 283 RSFVPKVQTADNRVIQEQLNQKIDECEGLQETIASLKQVLSIAHDSRN*ARCT--SQHYS 110 +SF +V+ ADNRVIQEQLNQKI ECE QETIASLKQ L+ A D RN + SQ++S Sbjct: 734 KSFELEVKAADNRVIQEQLNQKICECESQQETIASLKQQLADALDLRNFSHVVNHSQNFS 793 Query: 109 RKKGLQGEPHTEKENAETEDTKEDLLRQAQAFEIEE 2 K GE H +K N ++ E + QAQ EIE+ Sbjct: 794 GTKDYCGELHLDKGNVTINNSNEGIQLQAQISEIED 829