BLASTX nr result
ID: Atractylodes22_contig00016514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016514 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD16279.1| pulvinus outward-rectifying channel for potassium... 68 9e-10 ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectify... 67 2e-09 ref|XP_003519630.1| PREDICTED: calcium-activated outward-rectify... 67 2e-09 ref|XP_003617804.1| Outward rectifying potassium channel [Medica... 67 2e-09 gb|AAM64705.1| outward rectifying potassium channel KCO [Arabido... 65 4e-09 >gb|AAD16279.1| pulvinus outward-rectifying channel for potassium SPOCK1 [Samanea saman] Length = 352 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/47 (63%), Positives = 41/47 (87%) Frame = -1 Query: 221 YILYKLKEMGKISQEDMAPIMEEFERLDFDKTGTLTASDVLLSQSSW 81 +I+YKLKEMGKISQED+A IM++FE LD D++GTL+ SD+ L+Q+ W Sbjct: 304 FIIYKLKEMGKISQEDIALIMQQFEELDVDQSGTLSPSDLTLAQAPW 350 >ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 1 [Glycine max] gi|356552609|ref|XP_003544657.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 2 [Glycine max] Length = 348 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/46 (63%), Positives = 41/46 (89%) Frame = -1 Query: 221 YILYKLKEMGKISQEDMAPIMEEFERLDFDKTGTLTASDVLLSQSS 84 +++YKLKEMGKISQED++ +M+EFE+LD D +GTL+ SD+ L+QSS Sbjct: 303 FVIYKLKEMGKISQEDISLVMQEFEQLDVDDSGTLSTSDITLAQSS 348 >ref|XP_003519630.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like [Glycine max] Length = 349 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/46 (63%), Positives = 41/46 (89%) Frame = -1 Query: 221 YILYKLKEMGKISQEDMAPIMEEFERLDFDKTGTLTASDVLLSQSS 84 +++YKLKEMGKISQED++ +M+EFE+LD D +GTL+ SD+ L+QSS Sbjct: 304 FVIYKLKEMGKISQEDISLVMQEFEQLDVDDSGTLSTSDITLAQSS 349 >ref|XP_003617804.1| Outward rectifying potassium channel [Medicago truncatula] gi|355519139|gb|AET00763.1| Outward rectifying potassium channel [Medicago truncatula] Length = 349 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 221 YILYKLKEMGKISQEDMAPIMEEFERLDFDKTGTLTASDVLLSQSS 84 +++YKLKEMGKISQED+ +M+EFE LD D++GTL+ SD+ L+QSS Sbjct: 304 FVIYKLKEMGKISQEDITLVMKEFEELDIDQSGTLSVSDITLAQSS 349 >gb|AAM64705.1| outward rectifying potassium channel KCO [Arabidopsis thaliana] Length = 363 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/46 (58%), Positives = 43/46 (93%) Frame = -1 Query: 221 YILYKLKEMGKISQEDMAPIMEEFERLDFDKTGTLTASDVLLSQSS 84 +I+YKLKEMGKI ++D++ IM+EFE+LD+D++GTLT SD++L+Q++ Sbjct: 313 FIVYKLKEMGKIDEKDISGIMDEFEQLDYDESGTLTTSDIVLAQTT 358