BLASTX nr result
ID: Atractylodes22_contig00016381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016381 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA92325.1| geraniol-responsible factor 15 [Matricaria chamo... 100 1e-19 gb|ADU20406.1| alpha-mannosidase [Capsicum annuum] 94 9e-18 ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago trunca... 91 8e-17 ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycoper... 90 2e-16 gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum] 90 2e-16 >dbj|BAA92325.1| geraniol-responsible factor 15 [Matricaria chamomilla] Length = 76 Score = 100 bits (249), Expect = 1e-19 Identities = 55/79 (69%), Positives = 60/79 (75%), Gaps = 2/79 (2%) Frame = -2 Query: 361 MSLSANQGREEMEKKRLVWKVEN--DEPTTPQRGGPVDPQKLIVELAPMEIRTFILTLAP 188 MSLSANQGR EMEKKRLVWK E D+ T P RGGPVDP KL+VELAPMEIRTFILT++ Sbjct: 1 MSLSANQGRVEMEKKRLVWKAEGSKDDKTAPPRGGPVDPLKLVVELAPMEIRTFILTVS- 59 Query: 187 NAPKGKTISRRLAGSDLLL 131 KT+SRRL DL L Sbjct: 60 -----KTLSRRLVSPDLSL 73 >gb|ADU20406.1| alpha-mannosidase [Capsicum annuum] Length = 1030 Score = 94.4 bits (233), Expect = 9e-18 Identities = 49/76 (64%), Positives = 57/76 (75%), Gaps = 2/76 (2%) Frame = -2 Query: 400 QLFAHRKITTVSEMSLSANQGREEMEKKRLVWKVE--NDEPTTPQRGGPVDPQKLIVELA 227 +LF RKI + EMSLSANQ REEMEKKRL WK E +D P RGGPVDP KL+VELA Sbjct: 945 RLFPKRKINKIKEMSLSANQEREEMEKKRLKWKAEAPSDSQDVP-RGGPVDPTKLVVELA 1003 Query: 226 PMEIRTFILTLAPNAP 179 PMEIRTF++ L ++P Sbjct: 1004 PMEIRTFVINLGQSSP 1019 >ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago truncatula] gi|355499517|gb|AES80720.1| Lysosomal alpha-mannosidase [Medicago truncatula] Length = 1022 Score = 91.3 bits (225), Expect = 8e-17 Identities = 47/72 (65%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = -2 Query: 400 QLFAHRKITTVSEMSLSANQGREEMEKKRLVWKVE-NDEPTTPQRGGPVDPQKLIVELAP 224 +LF ++KI+ V+EMSLSANQ R EMEKKRLVWKVE + E + RGGPVDP KL+VEL P Sbjct: 938 KLFPNKKISKVTEMSLSANQERAEMEKKRLVWKVEGSSEESKVVRGGPVDPAKLVVELVP 997 Query: 223 MEIRTFILTLAP 188 MEIRTF + P Sbjct: 998 MEIRTFFVDFNP 1009 >ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycopersicum] gi|301176645|gb|ADK66339.1| alpha-mannosidase [Solanum lycopersicum] Length = 1028 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = -2 Query: 400 QLFAHRKITTVSEMSLSANQGREEMEKKRLVWKVENDEPTTP-QRGGPVDPQKLIVELAP 224 +LF RKI + EMSLSANQ R EMEKKRL WK E RGGPVDP KL+VELAP Sbjct: 945 RLFPKRKINKIREMSLSANQERVEMEKKRLKWKAEAPSDLRDVARGGPVDPTKLMVELAP 1004 Query: 223 MEIRTFILTLAPNAPKG 173 MEIRTF++ L+ + P+G Sbjct: 1005 MEIRTFVIDLSQSVPEG 1021 >gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum] Length = 1029 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = -2 Query: 400 QLFAHRKITTVSEMSLSANQGREEMEKKRLVWKVENDEPTTP-QRGGPVDPQKLIVELAP 224 +LF RKI + EMSLSANQ R EMEKKRL WK E RGGPVDP KL+VELAP Sbjct: 946 RLFPKRKINKIREMSLSANQERVEMEKKRLKWKAEAPSDLRDVARGGPVDPTKLMVELAP 1005 Query: 223 MEIRTFILTLAPNAPKG 173 MEIRTF++ L+ + P+G Sbjct: 1006 MEIRTFVIDLSQSVPEG 1022