BLASTX nr result
ID: Atractylodes22_contig00016342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016342 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ49160.1| protection of telomeres 1 protein [Helianthus arg... 108 4e-22 gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] 100 9e-20 gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana taba... 96 3e-18 gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tubero... 92 4e-17 emb|CBI15581.3| unnamed protein product [Vitis vinifera] 88 8e-16 >gb|ACJ49160.1| protection of telomeres 1 protein [Helianthus argophyllus] Length = 467 Score = 108 bits (270), Expect = 4e-22 Identities = 46/62 (74%), Positives = 56/62 (90%) Frame = -2 Query: 188 TASSGFLSLKEISEGHRFNLICKVLHICEVMDGEWMLFVWDGTDAPPVNVHTKLEEELEN 9 TAS+ FLSLK+I +G++ LICKVLH+CEV DGEW+LFVWDGTDAPPVN+HTKL+EE +N Sbjct: 155 TASNDFLSLKDIKQGNQSTLICKVLHVCEVKDGEWLLFVWDGTDAPPVNIHTKLDEEFDN 214 Query: 8 PL 3 PL Sbjct: 215 PL 216 >gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] Length = 466 Score = 100 bits (250), Expect = 9e-20 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = -2 Query: 188 TASSGFLSLKEISEGHRFNLICKVLHICEVMDGEWMLFVWDGTDAPPVNVHTKLEEELEN 9 T S+GF L I +G R NLICKVLHICEV GEWMLFVW+GTDAPP+++H+KLEEEL+N Sbjct: 152 TESNGFFQLNSIKQGIRSNLICKVLHICEVTQGEWMLFVWNGTDAPPLDIHSKLEEELKN 211 Query: 8 PL 3 PL Sbjct: 212 PL 213 >gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana tabacum] Length = 466 Score = 95.9 bits (237), Expect = 3e-18 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -2 Query: 167 SLKEISEGHRFNLICKVLHICEVMDGEWMLFVWDGTDAPPVNVHTKLEEELENPL 3 SLKEI EG RFNLICK+LH+CEV +WML VWDGTD PPV + TKLEEELENPL Sbjct: 160 SLKEIREGERFNLICKILHVCEVEKDKWMLLVWDGTDTPPVTIKTKLEEELENPL 214 >gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tuberosum] Length = 466 Score = 92.0 bits (227), Expect = 4e-17 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 167 SLKEISEGHRFNLICKVLHICEVMDGEWMLFVWDGTDAPPVNVHTKLEEELENPL 3 SLKEI EG RFNLICK++H+CEV +WML VWDG D PPV + TKLEEE+ENPL Sbjct: 160 SLKEIREGERFNLICKIVHVCEVEKNKWMLLVWDGMDTPPVTIKTKLEEEMENPL 214 >emb|CBI15581.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -2 Query: 170 LSLKEISEGHRFNLICKVLHICEVMDGEWMLFVWDGTDAPPVNVHTKLEEELENPL 3 LSL+EI EG R +L CK+LHICEV EW++FVWDGTD PPV+V T LE+E++NPL Sbjct: 184 LSLREIREGERVDLFCKILHICEVTKDEWIIFVWDGTDTPPVSVQTVLEDEMDNPL 239