BLASTX nr result
ID: Atractylodes22_contig00016309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016309 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA96893.1| serine carboxypeptidase [Arabidopsis thaliana] 63 3e-08 ref|NP_198467.2| serine carboxypeptidase-like 1 [Arabidopsis tha... 63 3e-08 ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis tha... 62 5e-08 ref|NP_177473.1| serine carboxypeptidase-like 2 [Arabidopsis tha... 62 5e-08 ref|NP_001031402.1| serine carboxypeptidase-like 13 [Arabidopsis... 62 6e-08 >dbj|BAA96893.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 512 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -2 Query: 163 VYSKSIVNTLXXXXXXXXXXXETGYVGIGEKEETQFFYYFIESERNPEEDPLI 5 V S SIV +L ETGY+G+GE+EE Q FYYFI+SERNP+EDPLI Sbjct: 27 VDSASIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLI 79 >ref|NP_198467.2| serine carboxypeptidase-like 1 [Arabidopsis thaliana] gi|75158705|sp|Q8RWJ6.1|SCP1_ARATH RecName: Full=Serine carboxypeptidase-like 1; Flags: Precursor gi|20260290|gb|AAM13043.1| serine carboxypeptidase [Arabidopsis thaliana] gi|22136494|gb|AAM91325.1| serine carboxypeptidase [Arabidopsis thaliana] gi|332006671|gb|AED94054.1| serine carboxypeptidase-like 1 [Arabidopsis thaliana] Length = 441 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -2 Query: 163 VYSKSIVNTLXXXXXXXXXXXETGYVGIGEKEETQFFYYFIESERNPEEDPLI 5 V S SIV +L ETGY+G+GE+EE Q FYYFI+SERNP+EDPLI Sbjct: 27 VDSASIVKSLPGFEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLI 79 >ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana] gi|75207280|sp|Q9SQX6.1|SCP7_ARATH RecName: Full=Serine carboxypeptidase-like 7; Flags: Precursor gi|12322774|gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana] gi|8567775|gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana] gi|21618017|gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana] gi|332641387|gb|AEE74908.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana] Length = 437 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -2 Query: 157 SKSIVNTLXXXXXXXXXXXETGYVGIGEKEETQFFYYFIESERNPEEDPLI 5 S SIV +L ETGY+G+GE+EE Q FYYFI+SERNP+EDPL+ Sbjct: 25 SASIVKSLPGFDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPQEDPLL 75 >ref|NP_177473.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana] gi|75169956|sp|Q9CAU3.1|SCP2_ARATH RecName: Full=Serine carboxypeptidase-like 2; Flags: Precursor gi|12324326|gb|AAG52135.1|AC010556_17 putative serine carboxypeptidase; 5659-8034 [Arabidopsis thaliana] gi|332197318|gb|AEE35439.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana] Length = 441 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 163 VYSKSIVNTLXXXXXXXXXXXETGYVGIGEKEETQFFYYFIESERNPEEDPLI 5 V S SIV L ETGY+GIGE+EE Q FYYFI+SERNP+EDPLI Sbjct: 27 VDSASIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLI 79 >ref|NP_001031402.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana] gi|330252292|gb|AEC07386.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana] Length = 411 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 160 YSKSIVNTLXXXXXXXXXXXETGYVGIGEKEETQFFYYFIESERNPEEDPLI 5 +S SIV L ETGY+GIGE+EE Q FYYFI+SE+NPEEDPL+ Sbjct: 21 HSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLL 72