BLASTX nr result
ID: Atractylodes22_contig00016265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016265 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002864409.1| hypothetical protein ARALYDRAFT_495661 [Arab... 54 1e-05 ref|XP_002862943.1| hypothetical protein ARALYDRAFT_497237 [Arab... 54 1e-05 >ref|XP_002864409.1| hypothetical protein ARALYDRAFT_495661 [Arabidopsis lyrata subsp. lyrata] gi|297310244|gb|EFH40668.1| hypothetical protein ARALYDRAFT_495661 [Arabidopsis lyrata subsp. lyrata] Length = 473 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Frame = +3 Query: 294 CYIFDLLI----SLQITPACNLPLKCLHGGGKVVIVN 392 C + DL++ SLQITPACNLPLKCL GGGK+VIVN Sbjct: 199 CKMADLVLCLGTSLQITPACNLPLKCLRGGGKIVIVN 235 >ref|XP_002862943.1| hypothetical protein ARALYDRAFT_497237 [Arabidopsis lyrata subsp. lyrata] gi|297308724|gb|EFH39202.1| hypothetical protein ARALYDRAFT_497237 [Arabidopsis lyrata subsp. lyrata] Length = 473 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Frame = +3 Query: 294 CYIFDLLI----SLQITPACNLPLKCLHGGGKVVIVN 392 C + DL++ SLQITPACNLPLKCL GGGK+VIVN Sbjct: 199 CKMADLVLCLGTSLQITPACNLPLKCLRGGGKIVIVN 235