BLASTX nr result
ID: Atractylodes22_contig00016059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016059 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit,... 75 4e-12 ref|XP_002274037.1| PREDICTED: cyclin-dependent kinases regulato... 75 4e-12 ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulato... 75 6e-12 ref|XP_004139562.1| PREDICTED: cyclin-dependent kinases regulato... 75 6e-12 gb|AFK45733.1| unknown [Lotus japonicus] 74 1e-11 >ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 260 RGWVHYAIHRPEPHIMLFRRPLNYQQNQENPAQAHQTLLAK 138 RGWVHYAIHRPEPHIMLFRRPLNYQQ QEN QA Q +LAK Sbjct: 50 RGWVHYAIHRPEPHIMLFRRPLNYQQQQEN--QAQQNILAK 88 >ref|XP_002274037.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2 isoform 1 [Vitis vinifera] gi|147800865|emb|CAN60128.1| hypothetical protein VITISV_018192 [Vitis vinifera] gi|297734891|emb|CBI17125.3| unnamed protein product [Vitis vinifera] Length = 88 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -3 Query: 260 RGWVHYAIHRPEPHIMLFRRPLNYQQNQENPAQAHQTLLAK 138 RGWVHYAIHRPEPHIMLFRRPLNYQQ QEN QA Q LLAK Sbjct: 50 RGWVHYAIHRPEPHIMLFRRPLNYQQQQEN--QAQQGLLAK 88 >ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Cucumis sativus] Length = 88 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 260 RGWVHYAIHRPEPHIMLFRRPLNYQQNQENPAQAHQTLLAK 138 RGWVHYAIHRPEPHIMLFRRPLNYQQ QEN QA Q +LAK Sbjct: 50 RGWVHYAIHRPEPHIMLFRRPLNYQQQQEN--QAQQQILAK 88 >ref|XP_004139562.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Cucumis sativus] Length = 59 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 260 RGWVHYAIHRPEPHIMLFRRPLNYQQNQENPAQAHQTLLAK 138 RGWVHYAIHRPEPHIMLFRRPLNYQQ QEN QA Q +LAK Sbjct: 21 RGWVHYAIHRPEPHIMLFRRPLNYQQQQEN--QAQQQILAK 59 >gb|AFK45733.1| unknown [Lotus japonicus] Length = 88 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 260 RGWVHYAIHRPEPHIMLFRRPLNYQQNQENPAQAHQTLLAK 138 RGWVHYAIHRPEPHIMLFRRPLNYQQ QEN QA Q++L K Sbjct: 50 RGWVHYAIHRPEPHIMLFRRPLNYQQQQEN--QAQQSMLVK 88