BLASTX nr result
ID: Atractylodes22_contig00016004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00016004 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38243.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002532757.1| GMP synthase, putative [Ricinus communis] gi... 65 8e-09 ref|XP_002269193.1| PREDICTED: putative glutamine amidotransfera... 64 1e-08 ref|XP_004167823.1| PREDICTED: LOW QUALITY PROTEIN: putative glu... 63 3e-08 ref|XP_004147509.1| PREDICTED: putative glutamine amidotransfera... 63 3e-08 >emb|CBI38243.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/54 (62%), Positives = 42/54 (77%), Gaps = 3/54 (5%) Frame = -3 Query: 154 KTGRETRSIQLFMEELG---VVKRFAVLLCAEDSDYVKKKYGGYFGVFVRMLAE 2 K G+ + ++ L + E G V KRFAVLLCAEDS+YVKKKYGGY+GVFV+ML E Sbjct: 35 KRGKPSFTVCLCVREGGGEMVEKRFAVLLCAEDSEYVKKKYGGYYGVFVKMLGE 88 >ref|XP_002532757.1| GMP synthase, putative [Ricinus communis] gi|223527486|gb|EEF29614.1| GMP synthase, putative [Ricinus communis] Length = 243 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 97 KRFAVLLCAEDSDYVKKKYGGYFGVFVRMLAE 2 K+FAVLLCAEDS+YVKKKYGGYFGVFVRML E Sbjct: 6 KKFAVLLCAEDSEYVKKKYGGYFGVFVRMLGE 37 >ref|XP_002269193.1| PREDICTED: putative glutamine amidotransferase YLR126C [Vitis vinifera] Length = 246 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 103 VVKRFAVLLCAEDSDYVKKKYGGYFGVFVRMLAE 2 V KRFAVLLCAEDS+YVKKKYGGY+GVFV+ML E Sbjct: 2 VEKRFAVLLCAEDSEYVKKKYGGYYGVFVKMLGE 35 >ref|XP_004167823.1| PREDICTED: LOW QUALITY PROTEIN: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Length = 243 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 100 VKRFAVLLCAEDSDYVKKKYGGYFGVFVRMLAE 2 +KRFA+LLCAEDS+YVK KYGGYFGVFVRML E Sbjct: 3 MKRFALLLCAEDSEYVKMKYGGYFGVFVRMLGE 35 >ref|XP_004147509.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Length = 243 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 100 VKRFAVLLCAEDSDYVKKKYGGYFGVFVRMLAE 2 +KRFA+LLCAEDS+YVK KYGGYFGVFVRML E Sbjct: 3 MKRFALLLCAEDSEYVKMKYGGYFGVFVRMLGE 35