BLASTX nr result
ID: Atractylodes22_contig00015903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015903 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521604.1| PREDICTED: glycogenin-2-like [Glycine max] 62 5e-08 ref|XP_003591231.1| Galactinol synthase [Medicago truncatula] gi... 60 2e-07 ref|XP_003591230.1| Galactinol synthase [Medicago truncatula] gi... 60 2e-07 emb|CAF21715.1| galactinol synthase 2 [Medicago sativa] 59 3e-07 ref|XP_003554564.1| PREDICTED: glycogenin-1-like [Glycine max] 59 5e-07 >ref|XP_003521604.1| PREDICTED: glycogenin-2-like [Glycine max] Length = 339 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 16 ESPEKVRWLANMGSNPTLYFNAGMFVFEPNIATYH 120 + PEKVRW +G P+LYFNAGMFVFEPNIATYH Sbjct: 167 QCPEKVRWPTELGQPPSLYFNAGMFVFEPNIATYH 201 >ref|XP_003591231.1| Galactinol synthase [Medicago truncatula] gi|355480279|gb|AES61482.1| Galactinol synthase [Medicago truncatula] Length = 325 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 16 ESPEKVRWLANMGSNPTLYFNAGMFVFEPNIATYH 120 + P+KV+W AN G P LYFNAGMFV+EPN+ATYH Sbjct: 164 QCPDKVQWPANFGPKPPLYFNAGMFVYEPNMATYH 198 >ref|XP_003591230.1| Galactinol synthase [Medicago truncatula] gi|355480278|gb|AES61481.1| Galactinol synthase [Medicago truncatula] Length = 312 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 16 ESPEKVRWLANMGSNPTLYFNAGMFVFEPNIATYH 120 + P+KV+W AN G P LYFNAGMFV+EPN+ATYH Sbjct: 151 QCPDKVQWPANFGPKPPLYFNAGMFVYEPNMATYH 185 >emb|CAF21715.1| galactinol synthase 2 [Medicago sativa] Length = 122 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 16 ESPEKVRWLANMGSNPTLYFNAGMFVFEPNIATYH 120 + P+KV+W +N G P LYFNAGMFVF+PN+ATYH Sbjct: 17 QCPDKVQWPSNFGPKPPLYFNAGMFVFQPNVATYH 51 >ref|XP_003554564.1| PREDICTED: glycogenin-1-like [Glycine max] Length = 335 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 16 ESPEKVRWLANMGSNPTLYFNAGMFVFEPNIATYH 120 + PEKV+W +G P+LYFNAGMFVFEP+IATYH Sbjct: 162 QCPEKVQWPTELGQPPSLYFNAGMFVFEPSIATYH 196