BLASTX nr result
ID: Atractylodes22_contig00015832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015832 (810 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACK37352.1| S-adenosyl-L-methionine synthetase [Chrysanthemum... 65 1e-11 sp|P50301.1|METK1_ACTCH RecName: Full=S-adenosylmethionine synth... 65 2e-11 ref|XP_002519480.1| s-adenosylmethionine synthetase, putative [R... 65 2e-11 emb|CBI30144.3| unnamed protein product [Vitis vinifera] 64 4e-11 ref|XP_002270100.1| PREDICTED: S-adenosylmethionine synthase 3 i... 64 4e-11 >gb|ACK37352.1| S-adenosyl-L-methionine synthetase [Chrysanthemum coronarium] Length = 390 Score = 64.7 bits (156), Expect(2) = 1e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 466 IHDKDILALIKENFDFRPGMMAINLDLKRGGNY 564 I DKDIL LIKENFDFRPGMMAINLDLKRGGN+ Sbjct: 328 IPDKDILVLIKENFDFRPGMMAINLDLKRGGNF 360 Score = 30.8 bits (68), Expect(2) = 1e-11 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 576 KRNTAYGHFGPEDPNFT 626 ++ AYGHFG EDP+FT Sbjct: 363 QKTAAYGHFGREDPDFT 379 >sp|P50301.1|METK1_ACTCH RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 1 gi|726030|gb|AAA81378.1| S-adenosylmethionine synthetase [Actinidia chinensis] Length = 390 Score = 65.5 bits (158), Expect(2) = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 463 KIHDKDILALIKENFDFRPGMMAINLDLKRGGN 561 KI DKDILALIKENFDFRPGM+AINLDLKRGGN Sbjct: 327 KIADKDILALIKENFDFRPGMIAINLDLKRGGN 359 Score = 29.6 bits (65), Expect(2) = 2e-11 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 576 KRNTAYGHFGPEDPNFT 626 ++ AYGHFG +DP+FT Sbjct: 363 QKTAAYGHFGRDDPDFT 379 >ref|XP_002519480.1| s-adenosylmethionine synthetase, putative [Ricinus communis] gi|223541343|gb|EEF42894.1| s-adenosylmethionine synthetase, putative [Ricinus communis] Length = 390 Score = 65.1 bits (157), Expect(2) = 2e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 463 KIHDKDILALIKENFDFRPGMMAINLDLKRGGNY 564 KI D+DILALIKE+FDFRPGMMAINLDLKRGGN+ Sbjct: 327 KIPDRDILALIKESFDFRPGMMAINLDLKRGGNF 360 Score = 29.6 bits (65), Expect(2) = 2e-11 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 576 KRNTAYGHFGPEDPNFT 626 ++ AYGHFG +DP+FT Sbjct: 363 QKTAAYGHFGRDDPDFT 379 >emb|CBI30144.3| unnamed protein product [Vitis vinifera] Length = 445 Score = 64.3 bits (155), Expect(2) = 4e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 463 KIHDKDILALIKENFDFRPGMMAINLDLKRGGNY 564 KI DKDIL LIKENFDFRPGM+AINLDLKRGGN+ Sbjct: 383 KIPDKDILDLIKENFDFRPGMIAINLDLKRGGNF 416 Score = 29.6 bits (65), Expect(2) = 4e-11 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 576 KRNTAYGHFGPEDPNFT 626 ++ AYGHFG +DP+FT Sbjct: 419 QKTAAYGHFGRDDPDFT 435 >ref|XP_002270100.1| PREDICTED: S-adenosylmethionine synthase 3 isoform 2 [Vitis vinifera] gi|359482256|ref|XP_003632745.1| PREDICTED: S-adenosylmethionine synthase 3 [Vitis vinifera] gi|223635285|sp|A7QJG1.1|METK3_VITVI RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 3 Length = 389 Score = 64.3 bits (155), Expect(2) = 4e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 463 KIHDKDILALIKENFDFRPGMMAINLDLKRGGNY 564 KI DKDIL LIKENFDFRPGM+AINLDLKRGGN+ Sbjct: 327 KIPDKDILDLIKENFDFRPGMIAINLDLKRGGNF 360 Score = 29.6 bits (65), Expect(2) = 4e-11 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 576 KRNTAYGHFGPEDPNFT 626 ++ AYGHFG +DP+FT Sbjct: 363 QKTAAYGHFGRDDPDFT 379