BLASTX nr result
ID: Atractylodes22_contig00015713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015713 (1249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628663.1| Sterol 4-alpha-methyl-oxidase [Medicago trun... 83 1e-13 ref|XP_004145282.1| PREDICTED: methylsterol monooxygenase 2-2-li... 81 5e-13 gb|ACJ84740.1| unknown [Medicago truncatula] 80 1e-12 ref|XP_003613314.1| Sterol 4-alpha-methyl-oxidase [Medicago trun... 80 1e-12 ref|XP_002520505.1| C-4 methyl sterol oxidase, putative [Ricinus... 80 1e-12 >ref|XP_003628663.1| Sterol 4-alpha-methyl-oxidase [Medicago truncatula] gi|355522685|gb|AET03139.1| Sterol 4-alpha-methyl-oxidase [Medicago truncatula] Length = 271 Score = 83.2 bits (204), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 1118 QYLITNFSDFQLAFLGNFLLHESVFFLSGLPFLYLERTGWLSKY 1249 QYLITNFSDFQLA LG+F LHESVFFLSGLPF++LER GWLSKY Sbjct: 10 QYLITNFSDFQLACLGSFFLHESVFFLSGLPFIWLERAGWLSKY 53 >ref|XP_004145282.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus] gi|449474027|ref|XP_004154053.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus] gi|449510890|ref|XP_004163802.1| PREDICTED: methylsterol monooxygenase 2-2-like [Cucumis sativus] Length = 262 Score = 81.3 bits (199), Expect = 5e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 1118 QYLITNFSDFQLAFLGNFLLHESVFFLSGLPFLYLERTGWLSKY 1249 QYLITNFSDFQLA +G+F++HESVFFLSGLPF+ LER GWLSKY Sbjct: 10 QYLITNFSDFQLACIGSFIIHESVFFLSGLPFILLERAGWLSKY 53 >gb|ACJ84740.1| unknown [Medicago truncatula] Length = 195 Score = 80.1 bits (196), Expect = 1e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 1118 QYLITNFSDFQLAFLGNFLLHESVFFLSGLPFLYLERTGWLSKY 1249 QYLIT+FSDFQLA LG+F LHESVFFLSGLPF+++ER GWLSKY Sbjct: 10 QYLITHFSDFQLACLGSFFLHESVFFLSGLPFVWIERAGWLSKY 53 >ref|XP_003613314.1| Sterol 4-alpha-methyl-oxidase [Medicago truncatula] gi|355514649|gb|AES96272.1| Sterol 4-alpha-methyl-oxidase [Medicago truncatula] Length = 271 Score = 80.1 bits (196), Expect = 1e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 1118 QYLITNFSDFQLAFLGNFLLHESVFFLSGLPFLYLERTGWLSKY 1249 QYLIT+FSDFQLA LG+F LHESVFFLSGLPF+++ER GWLSKY Sbjct: 10 QYLITHFSDFQLACLGSFFLHESVFFLSGLPFVWIERAGWLSKY 53 >ref|XP_002520505.1| C-4 methyl sterol oxidase, putative [Ricinus communis] gi|223540347|gb|EEF41918.1| C-4 methyl sterol oxidase, putative [Ricinus communis] Length = 269 Score = 79.7 bits (195), Expect = 1e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +2 Query: 1121 YLITNFSDFQLAFLGNFLLHESVFFLSGLPFLYLERTGWLSKY 1249 YLIT+FSDFQLA LG+F LHESVFFLSGLPF+Y ER GWLSKY Sbjct: 11 YLITHFSDFQLACLGSFFLHESVFFLSGLPFIYFERAGWLSKY 53