BLASTX nr result
ID: Atractylodes22_contig00015517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015517 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513886.1| phosphoglycerate mutase, putative [Ricinus c... 56 3e-06 >ref|XP_002513886.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223546972|gb|EEF48469.1| phosphoglycerate mutase, putative [Ricinus communis] Length = 347 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 2/71 (2%) Frame = -2 Query: 208 VGTIQSRWCIHNSAL-QECGNSSLRLASKGFKVDLGV-WGKERHCCSRKRGFCLIQASGF 35 +GT+QS +HNS QE N S++L SK KVD+G+ ++ CS KR F ++QAS Sbjct: 10 IGTLQSHQHLHNSGFNQEFQNISVKLISKCSKVDMGLSMSRKGEFCSAKRNFHVVQASAS 69 Query: 34 QTTVSDQVFTP 2 QT+V D V TP Sbjct: 70 QTSVVDPVSTP 80