BLASTX nr result
ID: Atractylodes22_contig00015457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015457 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264821.2| PREDICTED: ubiquinol-cytochrome c reductase ... 59 3e-07 emb|CBI38626.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002332696.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 gb|ABK96392.1| unknown [Populus trichocarpa x Populus deltoides] 56 3e-06 >ref|XP_002264821.2| PREDICTED: ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog [Vitis vinifera] Length = 285 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 RYVRRECICMSLTDKEAMFSGNFLFTSLENPKT 99 RY RREC C+SLTDKE++FSGNF F+SLENPK+ Sbjct: 248 RYARRECSCLSLTDKESIFSGNFTFSSLENPKS 280 >emb|CBI38626.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 RYVRRECICMSLTDKEAMFSGNFLFTSLENPKT 99 RY RREC C+SLTDKE++FSGNF F+SLENPK+ Sbjct: 317 RYARRECSCLSLTDKESIFSGNFTFSSLENPKS 349 >ref|XP_002332696.1| predicted protein [Populus trichocarpa] gi|222832950|gb|EEE71427.1| predicted protein [Populus trichocarpa] Length = 224 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 RYVRRECICMSLTDKEAMFSGNFLFTSLEN 90 RYVR E C+SLTDKEAMFSGNF+FTSLEN Sbjct: 188 RYVRHEASCLSLTDKEAMFSGNFMFTSLEN 217 >gb|ABK96392.1| unknown [Populus trichocarpa x Populus deltoides] Length = 291 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 RYVRRECICMSLTDKEAMFSGNFLFTSLEN 90 RYVR E C+SLTDKEAMFSGNF+FTSLEN Sbjct: 255 RYVRHEASCLSLTDKEAMFSGNFMFTSLEN 284