BLASTX nr result
ID: Atractylodes22_contig00015296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015296 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus ... 62 5e-08 >ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus communis] gi|223543328|gb|EEF44860.1| TMV resistance protein N, putative [Ricinus communis] Length = 1186 Score = 62.0 bits (149), Expect = 5e-08 Identities = 39/93 (41%), Positives = 54/93 (58%), Gaps = 1/93 (1%) Frame = +1 Query: 145 LFPLPQSIEFLFLCNCCFPMDNEVPVLFSGQPAISYMNLGLNGFGFLPNNID-LKMVRVL 321 L LP+ + L L +CC DN +P S P++ Y+NL N F FLP +I+ L M+ L Sbjct: 813 LSSLPRFLVSLSLADCCLS-DNVIPGDLSCLPSLEYLNLSGNPFRFLPESINSLGMLHSL 871 Query: 322 DLNCCWNLKSLLCLPSMLEELYTHSCVSLEKIT 420 L+ C +LKS+ LP+ L L C SLE+IT Sbjct: 872 VLDRCISLKSIPELPTDLNSLKAEDCTSLERIT 904