BLASTX nr result
ID: Atractylodes22_contig00015168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015168 (543 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528720.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002528720.1| conserved hypothetical protein [Ricinus communis] gi|223531814|gb|EEF33632.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 55.1 bits (131), Expect = 7e-06 Identities = 30/70 (42%), Positives = 42/70 (60%) Frame = +2 Query: 17 EDGRDDDSLTDEFPRRRRGRVPDYDNGCRDLGMRIEVLESHGDNLNPKGFIDWLATVREV 196 ED D DE PR+R+ +N CR+ GMR E+ E HG +L + F+DWLATV E+ Sbjct: 14 EDEDLGDEYDDEVPRQRQRPNAVDNNRCRESGMRTEIPEFHG-SLQAEEFLDWLATVEEI 72 Query: 197 DDMQGIFIEK 226 D +G+ +K Sbjct: 73 LDFKGVQEDK 82