BLASTX nr result
ID: Atractylodes22_contig00015156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015156 (959 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325292.1| predicted protein [Populus trichocarpa] gi|2... 66 1e-08 ref|XP_002267837.1| PREDICTED: PHD finger protein At1g33420 [Vit... 65 2e-08 ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like... 64 5e-08 ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like... 64 5e-08 ref|XP_002305350.1| predicted protein [Populus trichocarpa] gi|2... 64 7e-08 >ref|XP_002325292.1| predicted protein [Populus trichocarpa] gi|222862167|gb|EEE99673.1| predicted protein [Populus trichocarpa] Length = 679 Score = 66.2 bits (160), Expect = 1e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 917 LRAVSGSSWVSWRCLQGAVCRVGRLELLDYCLKELNGKQATD 792 LRAVSGS+WVSWR L+GAVC+V ELLD+CLKE+ GK A D Sbjct: 381 LRAVSGSNWVSWRALRGAVCKVAPPELLDHCLKEIGGKFAAD 422 >ref|XP_002267837.1| PREDICTED: PHD finger protein At1g33420 [Vitis vinifera] gi|296084820|emb|CBI27702.3| unnamed protein product [Vitis vinifera] Length = 692 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 917 LRAVSGSSWVSWRCLQGAVCRVGRLELLDYCLKELNGK 804 LRAV+GS+WVSWR L+GAVC+V ELLDYCLKEL GK Sbjct: 369 LRAVTGSNWVSWRALRGAVCKVAPPELLDYCLKELGGK 406 >ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus] Length = 668 Score = 63.9 bits (154), Expect = 5e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 917 LRAVSGSSWVSWRCLQGAVCRVGRLELLDYCLKELNGKQATD 792 L AVSGS+WV+WR L+GAVC+ G ELLDYCLK L GK ++D Sbjct: 344 LHAVSGSNWVTWRTLRGAVCKAGPPELLDYCLKNLGGKVSSD 385 >ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus] Length = 668 Score = 63.9 bits (154), Expect = 5e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 917 LRAVSGSSWVSWRCLQGAVCRVGRLELLDYCLKELNGKQATD 792 L AVSGS+WV+WR L+GAVC+ G ELLDYCLK L GK ++D Sbjct: 344 LHAVSGSNWVTWRTLRGAVCKAGPPELLDYCLKNLGGKVSSD 385 >ref|XP_002305350.1| predicted protein [Populus trichocarpa] gi|222848314|gb|EEE85861.1| predicted protein [Populus trichocarpa] Length = 688 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -1 Query: 917 LRAVSGSSWVSWRCLQGAVCRVGRLELLDYCLKELNGKQATDWITAS 777 LRAVSGS+WVSWR L+GAV +V ELLD+CLKEL GK A D + S Sbjct: 384 LRAVSGSNWVSWRALRGAVFKVAPPELLDHCLKELGGKFAADGMIVS 430