BLASTX nr result
ID: Atractylodes22_contig00015109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00015109 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK45302.1| unknown [Medicago truncatula] 80 2e-13 ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355... 80 2e-13 ref|XP_003552633.1| PREDICTED: protein YIF1B-like [Glycine max] 79 4e-13 ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] g... 79 5e-13 ref|XP_003555074.1| PREDICTED: protein YIF1B-A-like [Glycine max] 78 6e-13 >gb|AFK45302.1| unknown [Medicago truncatula] Length = 273 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 VLFSEVRSFDSSRHHYLLLFIALAQFPLFIWLGNITVNW 119 VLF+EVRS+DSS+HHYLLLFIALAQFPLF+WLGNITVNW Sbjct: 233 VLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNITVNW 271 >ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355496630|gb|AES77833.1| Protein YIF1B-B [Medicago truncatula] Length = 382 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 VLFSEVRSFDSSRHHYLLLFIALAQFPLFIWLGNITVNW 119 VLF+EVRS+DSS+HHYLLLFIALAQFPLF+WLGNITVNW Sbjct: 342 VLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNITVNW 380 >ref|XP_003552633.1| PREDICTED: protein YIF1B-like [Glycine max] Length = 273 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 VLFSEVRSFDSSRHHYLLLFIALAQFPLFIWLGNITVNW 119 VLF+EVRS+DSS+HHYLLLFIALAQFPLF WLGNITVNW Sbjct: 233 VLFAEVRSYDSSKHHYLLLFIALAQFPLFTWLGNITVNW 271 >ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] gi|223525796|gb|EEF28242.1| Protein YIF1A, putative [Ricinus communis] Length = 269 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 VLFSEVRSFDSSRHHYLLLFIALAQFPLFIWLGNITVNW 119 VLF+EVR++DSSRHHYLLLFIALAQFPLF WLGNIT+NW Sbjct: 229 VLFAEVRTYDSSRHHYLLLFIALAQFPLFTWLGNITINW 267 >ref|XP_003555074.1| PREDICTED: protein YIF1B-A-like [Glycine max] Length = 269 Score = 78.2 bits (191), Expect = 6e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 VLFSEVRSFDSSRHHYLLLFIALAQFPLFIWLGNITVNW 119 VLF+EVRS+DSSRHHYLLLFIAL QFPLF WLGNIT+NW Sbjct: 229 VLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNITINW 267