BLASTX nr result
ID: Atractylodes22_contig00014949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014949 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] 65 8e-09 >emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] Length = 206 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 140 PAHLLHCPQPFLVPLLKESGFVFFHRLVISFCLHTFL 30 P HLLHCPQPFLVPLLK++GF+FFHRLVI F + FL Sbjct: 160 PLHLLHCPQPFLVPLLKQNGFMFFHRLVIPFRSYLFL 196