BLASTX nr result
ID: Atractylodes22_contig00014906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014906 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136025.1| PREDICTED: blue-light photoreceptor PHR2-lik... 56 3e-06 ref|XP_004136024.1| PREDICTED: blue-light photoreceptor PHR2-lik... 56 3e-06 gb|ABK24574.1| unknown [Picea sitchensis] gi|224284157|gb|ACN398... 56 3e-06 ref|NP_182281.1| photolyase/blue-light receptor 2 [Arabidopsis t... 55 6e-06 gb|AAM64933.1| photolyase/blue-light receptor PHR2 [Arabidopsis ... 55 6e-06 >ref|XP_004136025.1| PREDICTED: blue-light photoreceptor PHR2-like isoform 2 [Cucumis sativus] gi|449498514|ref|XP_004160558.1| PREDICTED: blue-light photoreceptor PHR2-like isoform 2 [Cucumis sativus] Length = 451 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 YELLWRDFFRFITRKY-STAKQHNIPPVTACTGATA 107 +ELLWRDFFRFIT+KY ST KQ N P TACTGA A Sbjct: 416 FELLWRDFFRFITKKYNSTKKQPNPSPATACTGALA 451 >ref|XP_004136024.1| PREDICTED: blue-light photoreceptor PHR2-like isoform 1 [Cucumis sativus] gi|449498510|ref|XP_004160557.1| PREDICTED: blue-light photoreceptor PHR2-like isoform 1 [Cucumis sativus] Length = 459 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 YELLWRDFFRFITRKY-STAKQHNIPPVTACTGATA 107 +ELLWRDFFRFIT+KY ST KQ N P TACTGA A Sbjct: 424 FELLWRDFFRFITKKYNSTKKQPNPSPATACTGALA 459 >gb|ABK24574.1| unknown [Picea sitchensis] gi|224284157|gb|ACN39815.1| unknown [Picea sitchensis] Length = 526 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 3 YELLWRDFFRFITRKYSTA-KQHNIPPVTACTGATA 107 +ELLWRDFFRFIT+KY +A KQ + PVTACTGA A Sbjct: 490 FELLWRDFFRFITKKYGSAKKQQDASPVTACTGALA 525 >ref|NP_182281.1| photolyase/blue-light receptor 2 [Arabidopsis thaliana] gi|116248577|sp|Q8LB72.2|PHR2_ARATH RecName: Full=Blue-light photoreceptor PHR2 gi|2529668|gb|AAC62851.1| photolyase/blue-light receptor (PHR2) [Arabidopsis thaliana] gi|3319288|gb|AAC26199.1| photolyase/blue light photoreceptor PHR2 [Arabidopsis thaliana] gi|115646759|gb|ABJ17108.1| At2g47590 [Arabidopsis thaliana] gi|330255768|gb|AEC10862.1| photolyase/blue-light receptor 2 [Arabidopsis thaliana] Length = 447 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 YELLWRDFFRFITRKYSTAK-QHNIPPVTACTGATA 107 YELLWRDFFRFIT+KYS+AK Q P TACTGA A Sbjct: 412 YELLWRDFFRFITKKYSSAKTQVEAGPATACTGAFA 447 >gb|AAM64933.1| photolyase/blue-light receptor PHR2 [Arabidopsis thaliana] Length = 447 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 YELLWRDFFRFITRKYSTAK-QHNIPPVTACTGATA 107 YELLWRDFFRFIT+KYS+AK Q P TACTGA A Sbjct: 412 YELLWRDFFRFITKKYSSAKTQVEAGPATACTGAFA 447