BLASTX nr result
ID: Atractylodes22_contig00014863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014863 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268441.2| PREDICTED: F-box protein SKP2B-like [Vitis v... 87 2e-15 emb|CBI19930.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_002520258.1| F-box/LRR-repeat protein, putative [Ricinus ... 85 1e-14 ref|XP_002306672.1| predicted protein [Populus trichocarpa] gi|2... 84 2e-14 ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis... 83 4e-14 >ref|XP_002268441.2| PREDICTED: F-box protein SKP2B-like [Vitis vinifera] Length = 370 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 137 WKDIPMELLMRIVCLLDDRTVIVASGVCSGWRDAICWGLTHLSLS 3 WKD+PMELL+RIV L+DDRTVI+ASGVCSGWRDAIC GLTHLSLS Sbjct: 39 WKDVPMELLLRIVALVDDRTVIMASGVCSGWRDAICLGLTHLSLS 83 >emb|CBI19930.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 137 WKDIPMELLMRIVCLLDDRTVIVASGVCSGWRDAICWGLTHLSLS 3 WKD+PMELL+RIV L+DDRTVI+ASGVCSGWRDAIC GLTHLSLS Sbjct: 97 WKDVPMELLLRIVALVDDRTVIMASGVCSGWRDAICLGLTHLSLS 141 >ref|XP_002520258.1| F-box/LRR-repeat protein, putative [Ricinus communis] gi|223540477|gb|EEF42044.1| F-box/LRR-repeat protein, putative [Ricinus communis] Length = 373 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 137 WKDIPMELLMRIVCLLDDRTVIVASGVCSGWRDAICWGLTHLSLS 3 WKDIPMELL+RIV L+DDRT+I+ASGVCSGWRDAIC GLTHL LS Sbjct: 42 WKDIPMELLLRIVSLVDDRTIIMASGVCSGWRDAICLGLTHLCLS 86 >ref|XP_002306672.1| predicted protein [Populus trichocarpa] gi|222856121|gb|EEE93668.1| predicted protein [Populus trichocarpa] Length = 363 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 137 WKDIPMELLMRIVCLLDDRTVIVASGVCSGWRDAICWGLTHLSLS 3 WKDIP+ELL+RIV L+DDRTVI+ASGVCSGWRDAIC GLTHL LS Sbjct: 32 WKDIPVELLLRIVSLVDDRTVIMASGVCSGWRDAICMGLTHLCLS 76 >ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] gi|449517068|ref|XP_004165568.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] Length = 376 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 137 WKDIPMELLMRIVCLLDDRTVIVASGVCSGWRDAICWGLTHLSLS 3 WKDIPMELL++I+ L+DDRTVIVASGVC GWRDAIC+GL HLSLS Sbjct: 45 WKDIPMELLLQILSLVDDRTVIVASGVCRGWRDAICFGLAHLSLS 89