BLASTX nr result
ID: Atractylodes22_contig00014693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014693 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACM45080.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synth... 77 2e-12 ref|XP_003635302.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 75 5e-12 ref|XP_003519173.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 75 5e-12 gb|ACY29660.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synth... 75 7e-12 ref|XP_002285754.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 75 7e-12 >gb|ACM45080.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase 01 [Vitis vinifera] Length = 532 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 39 KWAVDSWKSKKALQLPEYPDEKDLQSVLQTLEAFPPIVF 155 KW VDSWK+KKALQLPEYP+E DL+SVLQTLEAFPPIVF Sbjct: 77 KWTVDSWKTKKALQLPEYPNESDLESVLQTLEAFPPIVF 115 >ref|XP_003635302.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic [Vitis vinifera] Length = 532 Score = 75.1 bits (183), Expect = 5e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 39 KWAVDSWKSKKALQLPEYPDEKDLQSVLQTLEAFPPIVF 155 KW VDSWK+KKALQLPEYP+E +L+SVLQTLEAFPPIVF Sbjct: 77 KWTVDSWKTKKALQLPEYPNESELESVLQTLEAFPPIVF 115 >ref|XP_003519173.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic-like [Glycine max] Length = 532 Score = 75.1 bits (183), Expect = 5e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 39 KWAVDSWKSKKALQLPEYPDEKDLQSVLQTLEAFPPIVF 155 KWAVDSWKSKKALQLPEYP +++L+SVL+TLEAFPPIVF Sbjct: 75 KWAVDSWKSKKALQLPEYPSQEELESVLKTLEAFPPIVF 113 >gb|ACY29660.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase 02 [Vitis vinifera] Length = 548 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 39 KWAVDSWKSKKALQLPEYPDEKDLQSVLQTLEAFPPIVF 155 KW+++SWKSKKALQLPEYPD +DL+SVL+TLEAFPPIVF Sbjct: 92 KWSIESWKSKKALQLPEYPDPEDLESVLRTLEAFPPIVF 130 >ref|XP_002285754.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic [Vitis vinifera] Length = 548 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 39 KWAVDSWKSKKALQLPEYPDEKDLQSVLQTLEAFPPIVF 155 KW+++SWKSKKALQLPEYPD +DL+SVL+TLEAFPPIVF Sbjct: 92 KWSIESWKSKKALQLPEYPDPEDLESVLRTLEAFPPIVF 130