BLASTX nr result
ID: Atractylodes22_contig00014649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014649 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279347.1| PREDICTED: eukaryotic translation initiation... 153 1e-35 ref|XP_002526864.1| eukaryotic translation initiation factor 3f,... 153 2e-35 ref|XP_002315172.1| predicted protein [Populus trichocarpa] gi|1... 150 8e-35 ref|XP_004138431.1| PREDICTED: eukaryotic translation initiation... 147 1e-33 ref|XP_003600862.1| Eukaryotic translation initiation factor 3 s... 143 2e-32 >ref|XP_002279347.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F [Vitis vinifera] gi|296086088|emb|CBI31529.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 153 bits (387), Expect = 1e-35 Identities = 74/79 (93%), Positives = 75/79 (94%) Frame = +3 Query: 9 VLQFVPLSTSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNSYVVP 188 VLQF P STSLSAKVHPLVIFNICDC+VRRPDQAERVIGTLLGSI PDGTVDIRNSY VP Sbjct: 8 VLQFFPSSTSLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVDIRNSYAVP 67 Query: 189 HNESSDQVALDIDYHHNML 245 HNESSDQVALDIDYHHNML Sbjct: 68 HNESSDQVALDIDYHHNML 86 >ref|XP_002526864.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] gi|223533763|gb|EEF35495.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] Length = 287 Score = 153 bits (386), Expect = 2e-35 Identities = 75/83 (90%), Positives = 77/83 (92%), Gaps = 2/83 (2%) Frame = +3 Query: 3 QTVLQFV--PLSTSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNS 176 QTVLQF P ST LSAKVHPLVIFNICDC+VRRPDQAERVIGTLLGS+LPDGTVDIRNS Sbjct: 6 QTVLQFTSAPSSTGLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNS 65 Query: 177 YVVPHNESSDQVALDIDYHHNML 245 Y VPHNESSDQVALDIDYHHNML Sbjct: 66 YAVPHNESSDQVALDIDYHHNML 88 >ref|XP_002315172.1| predicted protein [Populus trichocarpa] gi|118484603|gb|ABK94175.1| unknown [Populus trichocarpa] gi|222864212|gb|EEF01343.1| predicted protein [Populus trichocarpa] Length = 287 Score = 150 bits (380), Expect = 8e-35 Identities = 73/82 (89%), Positives = 78/82 (95%), Gaps = 1/82 (1%) Frame = +3 Query: 3 QTVLQFVPLSTS-LSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNSY 179 QTVLQF P S+S LSAKVHPLVIFNICDC+VRRPDQAERVIGTLLGS+LPDGTVDIRNSY Sbjct: 7 QTVLQFAPSSSSTLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSY 66 Query: 180 VVPHNESSDQVALDIDYHHNML 245 VPHNESS+QVALDIDYHHN+L Sbjct: 67 AVPHNESSEQVALDIDYHHNLL 88 >ref|XP_004138431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Cucumis sativus] gi|449517876|ref|XP_004165970.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Cucumis sativus] Length = 285 Score = 147 bits (370), Expect = 1e-33 Identities = 70/80 (87%), Positives = 74/80 (92%) Frame = +3 Query: 6 TVLQFVPLSTSLSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRNSYVV 185 TVLQF S +LSAKVHPLVIFNICDC+VRRPDQA+RVIGTLLGS+LPDGTVDIRNSY V Sbjct: 7 TVLQFSHSSNTLSAKVHPLVIFNICDCYVRRPDQADRVIGTLLGSVLPDGTVDIRNSYAV 66 Query: 186 PHNESSDQVALDIDYHHNML 245 PHNE SDQVALDIDYHHNML Sbjct: 67 PHNEFSDQVALDIDYHHNML 86 >ref|XP_003600862.1| Eukaryotic translation initiation factor 3 subunit F [Medicago truncatula] gi|217073538|gb|ACJ85129.1| unknown [Medicago truncatula] gi|355489910|gb|AES71113.1| Eukaryotic translation initiation factor 3 subunit F [Medicago truncatula] Length = 288 Score = 143 bits (360), Expect = 2e-32 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 3/84 (3%) Frame = +3 Query: 3 QTVLQFVPLSTS---LSAKVHPLVIFNICDCFVRRPDQAERVIGTLLGSILPDGTVDIRN 173 +TVLQF S+S LSAKVHPLV+FNICDC+VRRPDQAERVIGTLLGS+LPDGTVDIRN Sbjct: 6 RTVLQFSSSSSSSQSLSAKVHPLVVFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRN 65 Query: 174 SYVVPHNESSDQVALDIDYHHNML 245 SY VPHNES DQVALDI+YHHNML Sbjct: 66 SYAVPHNESVDQVALDIEYHHNML 89