BLASTX nr result
ID: Atractylodes22_contig00014624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014624 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35665.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_003638198.1| Endoribonuclease Dicer-like protein, partial... 61 1e-07 ref|XP_003602658.1| Endoribonuclease Dicer-like protein [Medicag... 61 1e-07 ref|XP_002278706.1| PREDICTED: ribonuclease 3-like protein 2-lik... 60 2e-07 ref|XP_002529460.1| ribonuclease III, putative [Ricinus communis... 60 2e-07 >gb|AFK35665.1| unknown [Medicago truncatula] Length = 344 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 174 MKMEDSITAVEAILKYKFKDKSLLQEALTHPSYTHGPSYQRLEF 305 MKMEDS+ AVE I+ Y F++K+LL+EALTH SY SY+RLEF Sbjct: 3 MKMEDSVAAVEKIIGYTFRNKNLLEEALTHSSYPESVSYERLEF 46 >ref|XP_003638198.1| Endoribonuclease Dicer-like protein, partial [Medicago truncatula] gi|355504133|gb|AES85336.1| Endoribonuclease Dicer-like protein, partial [Medicago truncatula] Length = 472 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 174 MKMEDSITAVEAILKYKFKDKSLLQEALTHPSYTHGPSYQRLEF 305 MKMEDS+ AVE I+ Y F++K+LL+EALTH SY SY+RLEF Sbjct: 108 MKMEDSVAAVEKIIGYTFRNKNLLEEALTHSSYPESVSYERLEF 151 >ref|XP_003602658.1| Endoribonuclease Dicer-like protein [Medicago truncatula] gi|355491706|gb|AES72909.1| Endoribonuclease Dicer-like protein [Medicago truncatula] Length = 344 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 174 MKMEDSITAVEAILKYKFKDKSLLQEALTHPSYTHGPSYQRLEF 305 MKMEDS+ AVE I+ Y F++K+LL+EALTH SY SY+RLEF Sbjct: 3 MKMEDSVAAVEKIIGYTFRNKNLLEEALTHSSYPESVSYERLEF 46 >ref|XP_002278706.1| PREDICTED: ribonuclease 3-like protein 2-like [Vitis vinifera] Length = 364 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +3 Query: 180 MEDSITAVEAILKYKFKDKSLLQEALTHPSYTHGPSYQRLEF 305 ME S+ AVE I+ YKF++K LL+EALTH SYT SYQRLEF Sbjct: 28 MEASVEAVERIINYKFRNKKLLEEALTHSSYTDSASYQRLEF 69 >ref|XP_002529460.1| ribonuclease III, putative [Ricinus communis] gi|223531076|gb|EEF32926.1| ribonuclease III, putative [Ricinus communis] Length = 342 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 174 MKMEDSITAVEAILKYKFKDKSLLQEALTHPSYTHGPSYQRLEF 305 M+ SI+AVE IL Y FK+K L++EALTH SYT P+YQRLEF Sbjct: 1 MEASSSISAVEKILNYTFKNKQLVEEALTHSSYTASPNYQRLEF 44