BLASTX nr result
ID: Atractylodes22_contig00014578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014578 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS... 69 5e-10 gb|ACU15762.1| unknown [Glycine max] 69 5e-10 ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus commun... 68 9e-10 ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|22286... 67 1e-09 ref|XP_002282318.1| PREDICTED: thioredoxin H2 [Vitis vinifera] g... 67 2e-09 >ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS88427.1| thioredoxin [Glycine max] Length = 135 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 404 DVAKDFGVEAMPTFILVKKGKERERIVGAKKDELHRMIEKHR 279 DVAK+F VEAMPTF+L KKGKE +++VGAKKDEL + IEKHR Sbjct: 91 DVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 132 >gb|ACU15762.1| unknown [Glycine max] Length = 157 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 404 DVAKDFGVEAMPTFILVKKGKERERIVGAKKDELHRMIEKHR 279 DVAK+F VEAMPTF+L KKGKE +++VGAKKDEL + IEKHR Sbjct: 113 DVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 154 >ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus communis] gi|223543469|gb|EEF45000.1| Thioredoxin H-type, putative [Ricinus communis] Length = 133 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -1 Query: 401 VAKDFGVEAMPTFILVKKGKERERIVGAKKDELHRMIEKHR 279 VA++FGV+AMPTF+LVKKGKE +R+VGAKKDEL + IEKHR Sbjct: 91 VAQEFGVQAMPTFVLVKKGKEVDRVVGAKKDELLKKIEKHR 131 >ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|222867034|gb|EEF04165.1| thioredoxin h [Populus trichocarpa] Length = 131 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 404 DVAKDFGVEAMPTFILVKKGKERERIVGAKKDELHRMIEKHR 279 DVA++FGV+AMPTF+LVKKG E +R+VGA+K+EL R IEKHR Sbjct: 90 DVAQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHR 131 >ref|XP_002282318.1| PREDICTED: thioredoxin H2 [Vitis vinifera] gi|147821566|emb|CAN70031.1| hypothetical protein VITISV_013686 [Vitis vinifera] gi|296087778|emb|CBI35034.3| unnamed protein product [Vitis vinifera] gi|452114370|gb|AGG09342.1| thioredoxin h4 [Vitis vinifera] Length = 136 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -1 Query: 404 DVAKDFGVEAMPTFILVKKGKERERIVGAKKDELHRMIEKHR 279 DVA++F V+AMPTF+L+KKGKE ER++GAKKDEL + I+KHR Sbjct: 90 DVAQEFTVQAMPTFVLLKKGKELERVIGAKKDELEKKIQKHR 131