BLASTX nr result
ID: Atractylodes22_contig00014572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014572 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS80320.1| thioredoxin protein [Nicotiana benthamiana] 153 2e-35 ref|NP_187329.1| thioredoxin-like protein CITRX [Arabidopsis tha... 151 6e-35 ref|XP_002882489.1| hypothetical protein ARALYDRAFT_477988 [Arab... 151 6e-35 ref|XP_002264063.1| PREDICTED: thioredoxin-like protein CITRX, c... 151 6e-35 gb|AAS80319.1| thioredoxin protein [Nicotiana benthamiana] 151 6e-35 >gb|AAS80320.1| thioredoxin protein [Nicotiana benthamiana] Length = 181 Score = 153 bits (386), Expect = 2e-35 Identities = 72/77 (93%), Positives = 75/77 (97%) Frame = +2 Query: 2 LIIDFYATWCGPCTLMAQELEMLAVEYESNIMIVKVDTDDEYEFARDMQVRGLPTLYFVS 181 LIIDFYATWCGPC LMAQELEMLAVEYESN +IVKVDTDDEYEFARDMQVRGLPTLYF+S Sbjct: 95 LIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFIS 154 Query: 182 PDPSKDAIRTEGLIPIQ 232 PDP+KDAIRTEGLIPIQ Sbjct: 155 PDPNKDAIRTEGLIPIQ 171 >ref|NP_187329.1| thioredoxin-like protein CITRX [Arabidopsis thaliana] gi|75186129|sp|Q9M7X9.1|CITRX_ARATH RecName: Full=Thioredoxin-like protein CITRX, chloroplastic; AltName: Full=Cf-9-interacting thioredoxin; Short=AtCiTrx; AltName: Full=Thioredoxin TRXP; Flags: Precursor gi|13878105|gb|AAK44130.1|AF370315_1 putative thioredoxin [Arabidopsis thaliana] gi|7549640|gb|AAF63825.1| thioredoxin, putative [Arabidopsis thaliana] gi|17104771|gb|AAL34274.1| putative thioredoxin [Arabidopsis thaliana] gi|332640928|gb|AEE74449.1| thioredoxin-like protein CITRX [Arabidopsis thaliana] Length = 183 Score = 151 bits (381), Expect = 6e-35 Identities = 70/77 (90%), Positives = 75/77 (97%) Frame = +2 Query: 2 LIIDFYATWCGPCTLMAQELEMLAVEYESNIMIVKVDTDDEYEFARDMQVRGLPTLYFVS 181 LI+DFYATWCGPC LMAQELEMLAVEYESN +IVKVDTDDEYEFARDMQVRGLPTL+F+S Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFIS 156 Query: 182 PDPSKDAIRTEGLIPIQ 232 PDPSKDAIRTEGLIP+Q Sbjct: 157 PDPSKDAIRTEGLIPLQ 173 >ref|XP_002882489.1| hypothetical protein ARALYDRAFT_477988 [Arabidopsis lyrata subsp. lyrata] gi|297328329|gb|EFH58748.1| hypothetical protein ARALYDRAFT_477988 [Arabidopsis lyrata subsp. lyrata] Length = 183 Score = 151 bits (381), Expect = 6e-35 Identities = 70/77 (90%), Positives = 75/77 (97%) Frame = +2 Query: 2 LIIDFYATWCGPCTLMAQELEMLAVEYESNIMIVKVDTDDEYEFARDMQVRGLPTLYFVS 181 LI+DFYATWCGPC LMAQELEMLAVEYESN +IVKVDTDDEYEFARDMQVRGLPTL+F+S Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFIS 156 Query: 182 PDPSKDAIRTEGLIPIQ 232 PDPSKDAIRTEGLIP+Q Sbjct: 157 PDPSKDAIRTEGLIPLQ 173 >ref|XP_002264063.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Vitis vinifera] gi|296087861|emb|CBI35117.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 151 bits (381), Expect = 6e-35 Identities = 71/77 (92%), Positives = 75/77 (97%) Frame = +2 Query: 2 LIIDFYATWCGPCTLMAQELEMLAVEYESNIMIVKVDTDDEYEFARDMQVRGLPTLYFVS 181 LIIDFYATWCGPC LMAQELEMLAVEYESN +IVKVDTDDEYEFARDMQVRGLPTLYF+S Sbjct: 98 LIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFIS 157 Query: 182 PDPSKDAIRTEGLIPIQ 232 PDP+K+AIRTEGLIPIQ Sbjct: 158 PDPTKNAIRTEGLIPIQ 174 >gb|AAS80319.1| thioredoxin protein [Nicotiana benthamiana] Length = 181 Score = 151 bits (381), Expect = 6e-35 Identities = 71/77 (92%), Positives = 74/77 (96%) Frame = +2 Query: 2 LIIDFYATWCGPCTLMAQELEMLAVEYESNIMIVKVDTDDEYEFARDMQVRGLPTLYFVS 181 LIIDFYATWCGPC LMAQELEMLAVEYESN +IVKVD DDEYEFARDMQVRGLPTLYF+S Sbjct: 95 LIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDADDEYEFARDMQVRGLPTLYFIS 154 Query: 182 PDPSKDAIRTEGLIPIQ 232 PDP+KDAIRTEGLIPIQ Sbjct: 155 PDPNKDAIRTEGLIPIQ 171