BLASTX nr result
ID: Atractylodes22_contig00014481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014481 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302675.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 gb|AAC19289.1| contains similarity to Arabidopsis membrane-assoc... 69 5e-10 ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] ... 69 5e-10 ref|NP_001154198.1| uncharacterized protein [Arabidopsis thalian... 69 5e-10 emb|CAB80949.1| hypothetical protein [Arabidopsis thaliana] 69 5e-10 >ref|XP_002302675.1| predicted protein [Populus trichocarpa] gi|222844401|gb|EEE81948.1| predicted protein [Populus trichocarpa] Length = 562 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 86 EEEEAFNSSSLSVKFGTPEALERVQNLTDVGAMTRLLHECIAYQRGL 226 ++E+ +S S+KFGTPEAL+ V+NLTDVGAMTRLLHECIAYQRGL Sbjct: 27 QQEDETTLNSPSIKFGTPEALDHVRNLTDVGAMTRLLHECIAYQRGL 73 >gb|AAC19289.1| contains similarity to Arabidopsis membrane-associated salt-inducible-like protein (GB:AL021637) [Arabidopsis thaliana] Length = 991 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 74 PSVTEEEEAFNS-SSLSVKFGTPEALERVQNLTDVGAMTRLLHECIAYQRGL 226 P + +++ A + S +VKFGTPEALE V++LTDVGAMTRLLHECIAYQR L Sbjct: 455 PEIEQDDAAAETVDSSTVKFGTPEALEYVRSLTDVGAMTRLLHECIAYQRSL 506 >ref|NP_192049.4| uncharacterized protein [Arabidopsis thaliana] gi|332656619|gb|AEE82019.1| uncharacterized protein [Arabidopsis thaliana] Length = 1110 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 74 PSVTEEEEAFNS-SSLSVKFGTPEALERVQNLTDVGAMTRLLHECIAYQRGL 226 P + +++ A + S +VKFGTPEALE V++LTDVGAMTRLLHECIAYQR L Sbjct: 374 PEIEQDDAAAETVDSSTVKFGTPEALEYVRSLTDVGAMTRLLHECIAYQRSL 425 >ref|NP_001154198.1| uncharacterized protein [Arabidopsis thaliana] gi|75154279|sp|Q8L838.1|COG4_ARATH RecName: Full=Conserved oligomeric Golgi complex subunit 4; Short=COG complex subunit 4; AltName: Full=Component of oligomeric Golgi complex 4 gi|21539537|gb|AAM53321.1| unknown protein [Arabidopsis thaliana] gi|34098793|gb|AAQ56779.1| At4g01400 [Arabidopsis thaliana] gi|332656620|gb|AEE82020.1| uncharacterized protein [Arabidopsis thaliana] Length = 738 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 74 PSVTEEEEAFNS-SSLSVKFGTPEALERVQNLTDVGAMTRLLHECIAYQRGL 226 P + +++ A + S +VKFGTPEALE V++LTDVGAMTRLLHECIAYQR L Sbjct: 2 PEIEQDDAAAETVDSSTVKFGTPEALEYVRSLTDVGAMTRLLHECIAYQRSL 53 >emb|CAB80949.1| hypothetical protein [Arabidopsis thaliana] Length = 1117 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +2 Query: 74 PSVTEEEEAFNS-SSLSVKFGTPEALERVQNLTDVGAMTRLLHECIAYQRGL 226 P + +++ A + S +VKFGTPEALE V++LTDVGAMTRLLHECIAYQR L Sbjct: 381 PEIEQDDAAAETVDSSTVKFGTPEALEYVRSLTDVGAMTRLLHECIAYQRSL 432