BLASTX nr result
ID: Atractylodes22_contig00014400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014400 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA17537.1| putative protein [Arabidopsis thaliana] gi|72689... 60 2e-07 >emb|CAA17537.1| putative protein [Arabidopsis thaliana] gi|7268915|emb|CAB79118.1| putative protein [Arabidopsis thaliana] Length = 648 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 3/60 (5%) Frame = -2 Query: 173 ILRIQLGTSHFEIKKAYRRLSVQYHPDKNPYPG*CCS*SY**LMY---FFCFNTDAHQYF 3 IL ++ G S EIKKAYRRLS+QYHPDKNP PG S S ++Y +C T+A++YF Sbjct: 85 ILGLEPGASDSEIKKAYRRLSIQYHPDKNPDPGRNASWSSSLIIYCLFVYCNGTEANKYF 144