BLASTX nr result
ID: Atractylodes22_contig00014085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00014085 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511111.1| alpha-2,8-sialyltransferase 8b, putative [Ri... 55 5e-06 >ref|XP_002511111.1| alpha-2,8-sialyltransferase 8b, putative [Ricinus communis] gi|223550226|gb|EEF51713.1| alpha-2,8-sialyltransferase 8b, putative [Ricinus communis] Length = 442 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 2 KAAVDHQKYVKETTMYPLEHSLGHSQLCTV 91 KAA+DHQK+VK TTMYPLEHS GH LCT+ Sbjct: 405 KAAIDHQKFVKGTTMYPLEHSPGHGMLCTI 434