BLASTX nr result
ID: Atractylodes22_contig00013948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013948 (687 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGZ09461.1| hypothetical protein PHYSODRAFT_521400 [Phytophth... 70 4e-10 emb|CCA14284.1| transmembrane protein putative [Albugo laibachii... 70 4e-10 ref|XP_640074.1| hypothetical protein DDB_G0282479 [Dictyosteliu... 70 4e-10 gb|EGG17258.1| phosphatidylinositol transfer protein [Dictyostel... 69 7e-10 tpg|DAA40808.1| TPA: putative RING zinc finger domain superfamil... 69 9e-10 >gb|EGZ09461.1| hypothetical protein PHYSODRAFT_521400 [Phytophthora sojae] Length = 321 Score = 70.1 bits (170), Expect = 4e-10 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +2 Query: 437 DHSSCVICFNDFGQNENVKVLPCEHHFHSQCIDAWLAINTRCPLCNTSV 583 + + C IC ND+ +++++VLPCEHHFH C+D WL +N+ CP C S+ Sbjct: 251 EDACCCICLNDYEPSQSLRVLPCEHHFHKDCVDEWLLVNSTCPTCRKSI 299 >emb|CCA14284.1| transmembrane protein putative [Albugo laibachii Nc14] Length = 320 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +2 Query: 443 SSCVICFNDFGQNENVKVLPCEHHFHSQCIDAWLAINTRCPLCNTSV 583 +SC IC DF NE +++LPC HHFHS CID WL +N CP C S+ Sbjct: 256 TSCCICLCDFELNEKIRLLPCNHHFHSGCIDEWLGLNATCPTCRISI 302 >ref|XP_640074.1| hypothetical protein DDB_G0282479 [Dictyostelium discoideum AX4] gi|60468089|gb|EAL66099.1| hypothetical protein DDB_G0282479 [Dictyostelium discoideum AX4] Length = 320 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = +2 Query: 419 ICVESEDHSSCVICFNDFGQNENVKVLPCEHHFHSQCIDAWLAINTRCPLCNTSV 583 I ++ D +C IC +DF N+ +K LPC HH+HS C++ WL I + CP+C TSV Sbjct: 263 IFLKGGDSKTCSICLDDFAVNDAIKTLPCIHHYHSDCVEKWLKIKSVCPICKTSV 317 >gb|EGG17258.1| phosphatidylinositol transfer protein [Dictyostelium fasciculatum] Length = 587 Score = 69.3 bits (168), Expect = 7e-10 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +2 Query: 431 SEDHSSCVICFNDFGQNENVKVLPCEHHFHSQCIDAWLAINTRCPLCNTSVT 586 S+ +SC IC ++F + ++K LPC HHFHS+CID WL I CP+C +S+T Sbjct: 536 SQQPTSCSICLDEFEIDNHLKTLPCLHHFHSECIDKWLKIKANCPICKSSLT 587 >tpg|DAA40808.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 246 Score = 68.9 bits (167), Expect = 9e-10 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 422 CVESEDHSSCVICFNDFGQNENVKVLP-CEHHFHSQCIDAWLAINTRCPLCNTSVTVDHI 598 C + D S C +C DFG + V+ LP C+H FH +CID+WL + CPLC V +DHI Sbjct: 185 CDQETDSSCCPVCLQDFGARQFVRALPQCQHIFHVRCIDSWLLRHASCPLCRAGVHIDHI 244