BLASTX nr result
ID: Atractylodes22_contig00013854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013854 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530485.1| PREDICTED: aspartic proteinase-like protein ... 67 1e-09 ref|XP_003552649.1| PREDICTED: aspartic proteinase-like protein ... 66 3e-09 ref|XP_003536162.1| PREDICTED: aspartic proteinase-like protein ... 66 3e-09 ref|XP_002320434.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 gb|AAF29389.1|AC009999_9 Contains similarity to nucellin from Ho... 66 3e-09 >ref|XP_003530485.1| PREDICTED: aspartic proteinase-like protein 2-like [Glycine max] Length = 488 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 102 EIGIGTPPKEYYVQVDT*SDIMWMNCIKCQRCPKRLSRG 218 +IGIGTPPK YY+QVDT SDIMW+NCI+C+ CP R S G Sbjct: 86 KIGIGTPPKNYYLQVDTGSDIMWVNCIQCKECPTRSSLG 124 >ref|XP_003552649.1| PREDICTED: aspartic proteinase-like protein 2-like [Glycine max] Length = 490 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 102 EIGIGTPPKEYYVQVDT*SDIMWMNCIKCQRCPKRLSRG 218 +IGIGTPPK YY+QVDT SDIMW+NCI+C+ CP R + G Sbjct: 88 KIGIGTPPKNYYLQVDTGSDIMWVNCIQCKECPTRSNLG 126 >ref|XP_003536162.1| PREDICTED: aspartic proteinase-like protein 2-like [Glycine max] Length = 475 Score = 66.2 bits (160), Expect = 3e-09 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +3 Query: 102 EIGIGTPPKEYYVQVDT*SDIMWMNCIKCQRCPKRLSRG 218 ++G+G+PPK+YYVQVDT SDI+W+NC+KC RCP++ G Sbjct: 73 KLGLGSPPKDYYVQVDTGSDILWVNCVKCSRCPRKSDLG 111 >ref|XP_002320434.1| predicted protein [Populus trichocarpa] gi|222861207|gb|EEE98749.1| predicted protein [Populus trichocarpa] Length = 485 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 102 EIGIGTPPKEYYVQVDT*SDIMWMNCIKCQRCPKRLSRG 218 +IGIGTP K+YYVQVDT SDIMW+NCI+C+ CPK S G Sbjct: 81 KIGIGTPTKDYYVQVDTGSDIMWVNCIQCRECPKTSSLG 119 >gb|AAF29389.1|AC009999_9 Contains similarity to nucellin from Hordeum vulgare gb|U87148. ESTs gb|T22068, gb|F14251, gb|F14237, gb|F14242 come from this gene [Arabidopsis thaliana] Length = 388 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 102 EIGIGTPPKEYYVQVDT*SDIMWMNCIKCQRCPKRLSRG 218 +IGIGTP K YYVQVDT SDIMW+NCI+C++CP+R + G Sbjct: 83 KIGIGTPAKSYYVQVDTGSDIMWVNCIQCKQCPRRSTLG 121