BLASTX nr result
ID: Atractylodes22_contig00013853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013853 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166415.1| PREDICTED: aspartic proteinase-like protein ... 86 2e-15 ref|XP_004140876.1| PREDICTED: aspartic proteinase-like protein ... 86 4e-15 ref|XP_002267046.2| PREDICTED: aspartic proteinase-like protein ... 86 4e-15 emb|CBI39464.3| unnamed protein product [Vitis vinifera] 86 4e-15 emb|CAN83119.1| hypothetical protein VITISV_043393 [Vitis vinifera] 86 4e-15 >ref|XP_004166415.1| PREDICTED: aspartic proteinase-like protein 2-like, partial [Cucumis sativus] Length = 420 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +3 Query: 75 VFGVNSKFSGKERSLSLFKAHDHLRHLQILASGVDLPLGGTGRPDAIGLYYAKIGIGTP 251 VF V K++G+ERSLS KAHD R L+ LA GVD+PLGG+GRPDA+GLYYAKIGIGTP Sbjct: 39 VFSVKYKYAGRERSLSTLKAHDISRQLRFLA-GVDIPLGGSGRPDAVGLYYAKIGIGTP 96 >ref|XP_004140876.1| PREDICTED: aspartic proteinase-like protein 2-like [Cucumis sativus] Length = 498 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +3 Query: 75 VFGVNSKFSGKERSLSLFKAHDHLRHLQILASGVDLPLGGTGRPDAIGLYYAKIGIGTP 251 +F V K++G+ERSLS KAHD R L+ LA G+D+PLGG+GRPDA+GLYYAKIGIGTP Sbjct: 39 IFSVKYKYAGRERSLSTLKAHDISRQLRFLA-GIDIPLGGSGRPDAVGLYYAKIGIGTP 96 >ref|XP_002267046.2| PREDICTED: aspartic proteinase-like protein 2-like [Vitis vinifera] Length = 502 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = +3 Query: 78 FGVNSKFSGKERSLSLFKAHDHLRHLQILASGVDLPLGGTGRPDAIGLYYAKIGIGTP 251 F + KF+G++RSL+ KAHD+ R L+ILA GVDLPLGGTGRP+A+GLYYAKIGIGTP Sbjct: 51 FSLKYKFAGQKRSLAALKAHDNSRQLRILA-GVDLPLGGTGRPEAVGLYYAKIGIGTP 107 >emb|CBI39464.3| unnamed protein product [Vitis vinifera] Length = 477 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = +3 Query: 78 FGVNSKFSGKERSLSLFKAHDHLRHLQILASGVDLPLGGTGRPDAIGLYYAKIGIGTP 251 F + KF+G++RSL+ KAHD+ R L+ILA GVDLPLGGTGRP+A+GLYYAKIGIGTP Sbjct: 51 FSLKYKFAGQKRSLAALKAHDNSRQLRILA-GVDLPLGGTGRPEAVGLYYAKIGIGTP 107 >emb|CAN83119.1| hypothetical protein VITISV_043393 [Vitis vinifera] Length = 431 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = +3 Query: 78 FGVNSKFSGKERSLSLFKAHDHLRHLQILASGVDLPLGGTGRPDAIGLYYAKIGIGTP 251 F + KF+G++RSL+ KAHD+ R L+ILA GVDLPLGGTGRP+A+GLYYAKIGIGTP Sbjct: 51 FSLKYKFAGQKRSLAALKAHDNSRQLRILA-GVDLPLGGTGRPEAVGLYYAKIGIGTP 107