BLASTX nr result
ID: Atractylodes22_contig00013667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013667 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265994.1| PREDICTED: putative RING-H2 finger protein A... 89 3e-16 ref|XP_002513558.1| ring finger protein, putative [Ricinus commu... 86 3e-15 ref|NP_200123.2| RING/U-box domain-containing protein-like prote... 86 4e-15 ref|XP_003524438.1| PREDICTED: putative RING-H2 finger protein A... 85 5e-15 ref|XP_002509961.1| ring finger protein, putative [Ricinus commu... 85 5e-15 >ref|XP_002265994.1| PREDICTED: putative RING-H2 finger protein ATL21A [Vitis vinifera] gi|297742332|emb|CBI34481.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 89.4 bits (220), Expect = 3e-16 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%) Frame = +2 Query: 5 ICLSDYQPKEPLRTTPECNHCFHSNCIDEWLKLNATCPMCR-----KSLVTPCSS 154 ICLS+YQPK+ +RT PECNHCFH +C+DEWLK+N TCP+CR SL TPCSS Sbjct: 315 ICLSEYQPKDTIRTIPECNHCFHVDCVDEWLKMNPTCPVCRNSPDASSLGTPCSS 369 >ref|XP_002513558.1| ring finger protein, putative [Ricinus communis] gi|223547466|gb|EEF48961.1| ring finger protein, putative [Ricinus communis] Length = 377 Score = 85.9 bits (211), Expect = 3e-15 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = +2 Query: 2 AICLSDYQPKEPLRTTPECNHCFHSNCIDEWLKLNATCPMCRKS 133 +ICLS+Y+PKE L+T PEC HCFH++CIDEWLKLNA+CP+CRKS Sbjct: 322 SICLSEYKPKETLKTIPECQHCFHADCIDEWLKLNASCPICRKS 365 >ref|NP_200123.2| RING/U-box domain-containing protein-like protein [Arabidopsis thaliana] gi|332008921|gb|AED96304.1| RING/U-box domain-containing protein-like protein [Arabidopsis thaliana] Length = 382 Score = 85.5 bits (210), Expect = 4e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +2 Query: 2 AICLSDYQPKEPLRTTPECNHCFHSNCIDEWLKLNATCPMCRKS 133 AICLS+Y+PKE LRT P+C HCFH++CIDEWLKLN TCP+CR S Sbjct: 331 AICLSEYEPKETLRTIPQCQHCFHADCIDEWLKLNGTCPVCRNS 374 >ref|XP_003524438.1| PREDICTED: putative RING-H2 finger protein ATL21B-like [Glycine max] Length = 582 Score = 85.1 bits (209), Expect = 5e-15 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +2 Query: 2 AICLSDYQPKEPLRTTPECNHCFHSNCIDEWLKLNATCPMCRKS 133 AICLS+YQPKE LR+ PECNH FH++CIDEWL+LNATCP+CR S Sbjct: 337 AICLSEYQPKETLRSIPECNHYFHADCIDEWLRLNATCPLCRNS 380 >ref|XP_002509961.1| ring finger protein, putative [Ricinus communis] gi|223549860|gb|EEF51348.1| ring finger protein, putative [Ricinus communis] Length = 392 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 5/55 (9%) Frame = +2 Query: 5 ICLSDYQPKEPLRTTPECNHCFHSNCIDEWLKLNATCPMCR-----KSLVTPCSS 154 ICL +YQPKE LRT PECNH FH++CIDEWLK+NATCP+CR S+ TP SS Sbjct: 313 ICLCEYQPKETLRTIPECNHYFHADCIDEWLKMNATCPLCRNSPDVSSVATPSSS 367