BLASTX nr result
ID: Atractylodes22_contig00013441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013441 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308119.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002308119.1| predicted protein [Populus trichocarpa] gi|222854095|gb|EEE91642.1| predicted protein [Populus trichocarpa] Length = 817 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +3 Query: 78 MRIVESVFTIIILLCLSVIVKSEVYIVTIEGEPVISYEGGVNGF 209 MR+VE T+++L L + K+EVYIVT+EGEPVISY GG+ GF Sbjct: 1 MRVVEFWRTVLVLFALLINGKAEVYIVTMEGEPVISYTGGIPGF 44