BLASTX nr result
ID: Atractylodes22_contig00013212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013212 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002891346.1| hypothetical protein ARALYDRAFT_891504 [Arab... 57 2e-06 >ref|XP_002891346.1| hypothetical protein ARALYDRAFT_891504 [Arabidopsis lyrata subsp. lyrata] gi|297337188|gb|EFH67605.1| hypothetical protein ARALYDRAFT_891504 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 276 CFGEVKDRFFIADLMKEVINEIGHQHVVQIIT 181 C G+VKD+FFI++LMKEVINE+GHQ+VVQIIT Sbjct: 71 CSGKVKDKFFISNLMKEVINEVGHQNVVQIIT 102