BLASTX nr result
ID: Atractylodes22_contig00013054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00013054 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51743.1|AC068667_22 phosphoribosylanthranilate isomerase; ... 80 2e-13 gb|ADZ24713.1| phosphoribosylanthranilate isomerase [Solanum pen... 76 3e-12 ref|XP_002311229.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_002318201.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 ref|XP_002528298.1| tryptophan biosynthesis protein, putative [R... 75 6e-12 >gb|AAG51743.1|AC068667_22 phosphoribosylanthranilate isomerase; 42098-40571 [Arabidopsis thaliana] Length = 368 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 149 GSVSQRFACDKGFNWSQFKLPPIRSKHGWLLAGGIKPENVSEALSILKP 3 GS+ F C KGFNW+QFKLP +RS++GWLLAGGI P NVSEALSIL+P Sbjct: 240 GSIITIFCCGKGFNWAQFKLPSVRSRNGWLLAGGINPTNVSEALSILQP 288 >gb|ADZ24713.1| phosphoribosylanthranilate isomerase [Solanum pennellii] Length = 275 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -1 Query: 119 KGFNWSQFKLPPIRSKHGWLLAGGIKPENVSEALSILKP 3 KGFNW+QFKLP IRSKHGWLLAGGI PENV EALS LKP Sbjct: 203 KGFNWAQFKLPSIRSKHGWLLAGGINPENVCEALSALKP 241 >ref|XP_002311229.1| predicted protein [Populus trichocarpa] gi|222851049|gb|EEE88596.1| predicted protein [Populus trichocarpa] Length = 254 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 119 KGFNWSQFKLPPIRSKHGWLLAGGIKPENVSEALSILKP 3 KGFNW+ F+LPPI+SK+GWLLAGGIKPENVSEALS+LKP Sbjct: 182 KGFNWTGFELPPIKSKNGWLLAGGIKPENVSEALSLLKP 220 >ref|XP_002318201.1| predicted protein [Populus trichocarpa] gi|222858874|gb|EEE96421.1| predicted protein [Populus trichocarpa] Length = 206 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -1 Query: 119 KGFNWSQFKLPPIRSKHGWLLAGGIKPENVSEALSILKP 3 KGFNW+ F+LPPI+SK+GWLLAGGIKPENVSEA+S+LKP Sbjct: 134 KGFNWTHFELPPIKSKNGWLLAGGIKPENVSEAVSLLKP 172 >ref|XP_002528298.1| tryptophan biosynthesis protein, putative [Ricinus communis] gi|223532253|gb|EEF34056.1| tryptophan biosynthesis protein, putative [Ricinus communis] Length = 275 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 119 KGFNWSQFKLPPIRSKHGWLLAGGIKPENVSEALSILKP 3 KGFNW+QFKLPPIRSKHGWLLAGGI P NV EA+S LKP Sbjct: 203 KGFNWAQFKLPPIRSKHGWLLAGGINPGNVCEAVSTLKP 241