BLASTX nr result
ID: Atractylodes22_contig00012873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012873 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] 40 4e-06 >emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] Length = 2232 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -1 Query: 289 EIRAEVRLLSPVGLNKAMEMASMVEERNKTVH--RWGNSKTTTPMRKTVD 146 EIRAE RLL P GL MEMA VE+RN + R N +T M T + Sbjct: 897 EIRAEQRLLQPYGLGHLMEMAQRVEDRNLAMRAAREPNGPKSTKMLSTAN 946 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -2 Query: 93 MSNKRTGEFRRLSDQELQQRRQQGLCYRCDE 1 MS +R +RL++ ELQ RR++GL ++C+E Sbjct: 968 MSQRREIPIKRLTESELQARREKGLWFKCEE 998