BLASTX nr result
ID: Atractylodes22_contig00012741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012741 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA40466.1| unknown [Solanum tuberosum] 81 8e-14 ref|XP_002514934.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 ref|NP_172067.1| protein restricted tev movement 1 [Arabidopsis ... 59 3e-07 emb|CBW45850.1| RTM1 protein [Arabidopsis thaliana] 59 3e-07 emb|CBW45829.1| RTM1 protein [Arabidopsis thaliana] 59 3e-07 >gb|ABA40466.1| unknown [Solanum tuberosum] Length = 162 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/81 (50%), Positives = 49/81 (60%) Frame = +1 Query: 1 VVFDYPSEFLTSVSGGYDGDNKLISITFGTNKREYGPFGADVVQVKEQFNYDFGPRNKIG 180 V+ DYPSEFLTS+SG Y + L +I F TNK YGPFG FN+ G + G Sbjct: 67 VLLDYPSEFLTSLSGSYVNNGGLEAIKFNTNKGSYGPFGQPTSDA-YHFNFQLGNHSLFG 125 Query: 181 GFHGTVFDSCVYAIGIYIKPV 243 GFHGT V +IGIY+KPV Sbjct: 126 GFHGTTSSYAVDSIGIYVKPV 146 >ref|XP_002514934.1| conserved hypothetical protein [Ricinus communis] gi|223545985|gb|EEF47488.1| conserved hypothetical protein [Ricinus communis] Length = 190 Score = 70.5 bits (171), Expect = 1e-10 Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 16/98 (16%) Frame = +1 Query: 1 VVFDYPSEFLTSVSGGYDGD--NKLISITFGTNKREYGPFG----ADVVQVKE------- 141 V FDYP+EFL +SG YDG N ++S+TF TNK+ YGPFG +V +E Sbjct: 69 VKFDYPAEFLKKLSGKYDGTYGNGIVSLTFTTNKKTYGPFGNCEDHRMVDFEEFDASEDY 128 Query: 142 ---QFNYDFGPRNKIGGFHGTVFDSCVYAIGIYIKPVA 246 F++D G N+ GGFHG V + +IGIY+ A Sbjct: 129 RFPDFDFDVG-ENRFGGFHGFVGRDTLLSIGIYVNLAA 165 >ref|NP_172067.1| protein restricted tev movement 1 [Arabidopsis thaliana] gi|6503088|gb|AAF14583.1|AF191302_1 RTM1 [Arabidopsis thaliana] gi|6850305|gb|AAF29382.1|AC009999_2 Contains similarity to a jasmonate inducible protein from Brassica napus gb|Y11483 and contains a Jacalin-like lectin PF|01419 domain. EST gb|AI998212 comes from this gene [Arabidopsis thaliana] gi|293337517|gb|ADE43047.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337519|gb|ADE43048.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337523|gb|ADE43050.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337525|gb|ADE43051.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337527|gb|ADE43052.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337531|gb|ADE43054.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337533|gb|ADE43055.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337535|gb|ADE43056.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337537|gb|ADE43057.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337539|gb|ADE43058.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337541|gb|ADE43059.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337543|gb|ADE43060.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337547|gb|ADE43062.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337549|gb|ADE43063.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337551|gb|ADE43064.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337553|gb|ADE43065.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337558|gb|ADE43067.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337560|gb|ADE43068.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337562|gb|ADE43069.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337564|gb|ADE43070.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337566|gb|ADE43071.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337568|gb|ADE43072.1| restricted tev movement 1 [Arabidopsis thaliana] gi|302608898|emb|CBW45825.1| RTM1 protein [Arabidopsis thaliana] gi|302608900|emb|CBW45826.1| RTM1 protein [Arabidopsis thaliana] gi|302608904|emb|CBW45828.1| RTM1 protein [Arabidopsis thaliana] gi|302608908|emb|CBW45830.1| RTM1 protein [Arabidopsis thaliana] gi|302608910|emb|CBW45831.1| RTM1 protein [Arabidopsis thaliana] gi|302608912|emb|CBW45832.1| RTM1 protein [Arabidopsis thaliana] gi|302608914|emb|CBW45833.1| RTM1 protein [Arabidopsis thaliana] gi|302608916|emb|CBW45834.1| RTM1 protein [Arabidopsis thaliana] gi|302608918|emb|CBW45835.1| RTM1 protein [Arabidopsis thaliana] gi|302608922|emb|CBW45837.1| RTM1 protein [Arabidopsis thaliana] gi|302608924|emb|CBW45838.1| RTM1 protein [Arabidopsis thaliana] gi|302608926|emb|CBW45839.1| RTM1 protein [Arabidopsis thaliana] gi|302608928|emb|CBW45840.1| RTM1 protein [Arabidopsis thaliana] gi|302608930|emb|CBW45841.1| RTM1 protein [Arabidopsis thaliana] gi|302608932|emb|CBW45842.1| RTM1 protein [Arabidopsis thaliana] gi|302608934|emb|CBW45843.1| RTM1 protein [Arabidopsis thaliana] gi|302608936|emb|CBW45844.1| RTM1 protein [Arabidopsis thaliana] gi|302608938|emb|CBW45845.1| RTM1 protein [Arabidopsis thaliana] gi|302608940|emb|CBW45846.1| RTM1 protein [Arabidopsis thaliana] gi|302608942|emb|CBW45847.1| RTM1 protein [Arabidopsis thaliana] gi|302608944|emb|CBW45848.1| RTM1 protein [Arabidopsis thaliana] gi|302608946|emb|CBW45849.1| RTM1 protein [Arabidopsis thaliana] gi|302608952|emb|CBW45852.1| RTM1 protein [Arabidopsis thaliana] gi|302608954|emb|CBW45853.1| RTM1 protein [Arabidopsis thaliana] gi|302608956|emb|CBW45854.1| RTM1 protein [Arabidopsis thaliana] gi|302608958|emb|CBW45855.1| RTM1 protein [Arabidopsis thaliana] gi|332189767|gb|AEE27888.1| protein restricted tev movement 1 [Arabidopsis thaliana] Length = 174 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +1 Query: 1 VVFDYPSEFLTSVSGGY---DGDNK-LISITFGTNKREYGPFGADVVQVKEQFNYDFGPR 168 + +YP E++T +SG Y + +N + S+ F TN EYGPFG ++F + G Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSS-NDKFAFKLGKS 128 Query: 169 NKIGGFHGTVFDSCVYAIGIYIKP 240 + GGFHGT S + IG+Y++P Sbjct: 129 PQFGGFHGTYDASGLQYIGVYLRP 152 >emb|CBW45850.1| RTM1 protein [Arabidopsis thaliana] Length = 168 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +1 Query: 1 VVFDYPSEFLTSVSGGY---DGDNK-LISITFGTNKREYGPFGADVVQVKEQFNYDFGPR 168 + +YP E++T +SG Y + +N + S+ F TN EYGPFG ++F + G Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSS-NDKFAFKLGKS 128 Query: 169 NKIGGFHGTVFDSCVYAIGIYIKP 240 + GGFHGT S + IG+Y++P Sbjct: 129 PQFGGFHGTYDASGLQYIGVYLRP 152 >emb|CBW45829.1| RTM1 protein [Arabidopsis thaliana] Length = 174 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +1 Query: 1 VVFDYPSEFLTSVSGGY---DGDNK-LISITFGTNKREYGPFGADVVQVKEQFNYDFGPR 168 + +YP E++T +SG Y + +N + S+ F TN EYGPFG ++F + G Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSS-NDKFAFKLGKS 128 Query: 169 NKIGGFHGTVFDSCVYAIGIYIKP 240 + GGFHGT S + IG+Y++P Sbjct: 129 PQFGGFHGTYDASGLQYIGVYLRP 152