BLASTX nr result
ID: Atractylodes22_contig00012597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00012597 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633897.1| PREDICTED: COP9 signalosome complex subunit ... 74 1e-11 gb|ABK94750.1| unknown [Populus trichocarpa] 74 1e-11 ref|XP_002273686.1| PREDICTED: COP9 signalosome complex subunit ... 74 1e-11 ref|XP_003546686.1| PREDICTED: COP9 signalosome complex subunit ... 69 4e-10 ref|XP_003542787.1| PREDICTED: COP9 signalosome complex subunit ... 69 4e-10 >ref|XP_003633897.1| PREDICTED: COP9 signalosome complex subunit 7 isoform 3 [Vitis vinifera] Length = 244 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 437 ADIDFRGHEEMFSEPGGVMDYDEDRSRPKRRRHPL 333 ADIDFRGHEE++SEPGGVMDY+EDRSRPKRRRHP+ Sbjct: 209 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 243 >gb|ABK94750.1| unknown [Populus trichocarpa] Length = 259 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 437 ADIDFRGHEEMFSEPGGVMDYDEDRSRPKRRRHPL 333 ADIDFRGHEE++SEPGGVMDY+EDRSRPKRRRHP+ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 258 >ref|XP_002273686.1| PREDICTED: COP9 signalosome complex subunit 7 isoform 1 [Vitis vinifera] gi|297734611|emb|CBI16662.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 437 ADIDFRGHEEMFSEPGGVMDYDEDRSRPKRRRHPL 333 ADIDFRGHEE++SEPGGVMDY+EDRSRPKRRRHP+ Sbjct: 224 ADIDFRGHEEIYSEPGGVMDYEEDRSRPKRRRHPI 258 >ref|XP_003546686.1| PREDICTED: COP9 signalosome complex subunit 7-like [Glycine max] Length = 259 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 437 ADIDFRGHEEMFSEPGGVMDYDEDRSRPKRRRHPL 333 ADIDFRGHEE+ SE GGVMDY+EDRSRPKRRRHP+ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPI 258 >ref|XP_003542787.1| PREDICTED: COP9 signalosome complex subunit 7-like [Glycine max] Length = 259 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 437 ADIDFRGHEEMFSEPGGVMDYDEDRSRPKRRRHPL 333 ADIDFRGHEE+ SE GGVMDY+EDRSRPKRRRHP+ Sbjct: 224 ADIDFRGHEEICSESGGVMDYEEDRSRPKRRRHPI 258